From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005625000
  • symbol?: budB
  • description?: acetolactate synthase

      descriptions from strain specific annotations:

    • acetolactate synthase
    • acetolactate synthase AlsS
    • Acetolactate synthase, catabolic
    • Acetolactate synthase, large subunit
    • alpha-acetolactate synthase
    • putative acetolactate synthase
  • strand?: -
  • coordinates?: 5761216..5762903
  • synteny block?: BlockID0043780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2199 (budB)
    N315:
    SA2008 (alsS)
    NCTC8325:
    Newman:
    NWMN_2111 (alsS)
    USA300_FPR3757:
    04-02981:
    SA2981_2144 (alsS)
    08BA02176:
    C248_2250
    11819-97:
    MS7_2235 (alsS)
    71193:
    ST398NM01_2268
    ECT-R 2:
    ECTR2_2068 (alsS)
    ED133:
    SAOV_2252c
    ED98:
    SAAV_2268 (budB)
    HO 5096 0412:
    SAEMRSA15_21140
    JH1:
    SaurJH1_2276
    JH9:
    SaurJH9_2237
    JKD6008:
    SAA6008_02248 (alsS)
    JKD6159:
    SAA6159_02119 (alsS)
    LGA251:
    SARLGA251_20010
    M013:
    M013TW_2174
    MRSA252:
    SAR2297
    MSHR1132:
    SAMSHR1132_20380
    MSSA476:
    SAS2106
    Mu3:
    SAHV_2191 (alsS)
    Mu50:
    SAV2207 (alsS)
    MW2:
    MW2132 (alsS)
    RF122:
    SAB2087c
    ST398:
    SAPIG2268 (alsS)
    T0131:
    SAT0131_02383 (purQ)
    TCH60:
    HMPREF0772_10984 (alsS)
    TW20:
    SATW20_23450
    USA300_TCH1516:
    USA300HOU_2202 (alsS)
    VC40:
    SAVC_09925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTDKKYTAADMVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQ
    N315            MTDKKYTAADMVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQ
    NCTC8325        MTDKKYTAADMVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQ
    Newman          MTDKKYTAADMVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQ
    USA300_FPR3757  MTDKKYTAADMVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQ
                    ************************************************************

    COL             GIGRLTGKPGVVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNA
    N315            GIGRLTGKPGVVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNA
    NCTC8325        GIGRLTGKPGVVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNA
    Newman          GIGRLTGKPGVVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNA
    USA300_FPR3757  GIGRLTGKPGVVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNA
                    ************************************************************

    COL             ALLKYSSKYSEEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPVESKAISLCQ
    N315            ALLKYSSKYSEEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPVESKAISLCQ
    NCTC8325        ALLKYSSKYSEEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPVESKAISLCQ
    Newman          ALLKYSSKYSEEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPVESKAISLCQ
    USA300_FPR3757  ALLKYSSKYSEEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPVESKAISLCQ
                    ************************************************************

    COL             KPNLGVPSEQDINDVIEAIKNASFPVLLAGMRSSSAEETNAIRKLVERTNLPVVETFQGA
    N315            KPNLGVPSEQDINDVIEAIKNASFPVLLAGMRSSSAEETNAIRKLVERTNLPVVETFQGA
    NCTC8325        KTNLGVPSEQDINDVIEAIKNASFPVLLAGMRSSSAEETNAIRKLVERTNLPVVETFQGA
    Newman          KPNLGVPSEQDINDVIEAIKNASFPVLLAGMRSSSAEETNAIRKLVERTNLPVVETFQGA
    USA300_FPR3757  KPNLGVPSEQDINDVIEAIKNASFPVLLAGMRSSSAEETNAIRKLVERTNLPVVETFQGA
                    *.**********************************************************

    COL             GVISRELENHFFGRVGLFRNQVGDELLRKSDLVVTIGYDPIEYEASNWNKELETQIINID
    N315            GVISRELENHFFGRVGLFRNQVGDELLRKSDLVVTIGYDPIEYEASNWNKELETQIINID
    NCTC8325        GVISRELENHFFGRVGLFRNQVGDELLRKSDLVVTIGYDPIEYEASNWNKELETQIINID
    Newman          GVISRELENHFFGRVGLFRNQVGDELLRKSDLVVTIGYDPIEYEASNWNKELETQIINID
    USA300_FPR3757  GVISRELENHFFGRVGLFRNQVGDELLRKSDLVVTIGYDPIEYEASNWNKELETQIINID
                    ************************************************************

    COL             EVQAEITNYMQPKKELIGNIAKTIEMISEKVDEPFINQQHLDELEQLRTHIDEETGIKAT
    N315            EVQAEITNYMQPKKELIGNIAKTIEMISEKVDEPFINQQHLDELEQLRTHIDEETGIKAT
    NCTC8325        EVQAEITNYMQPKKELIGNIAKTIEMISEKVDEPFINQQHLDELEQLRTHIDEETGIKAT
    Newman          EVQAEITNYMQPKKELIGNIAKTIEMISEKVDEPFINQQHLDELEQLRTHIDEETGIKAT
    USA300_FPR3757  EVQAEITNYMQPKKELIGNIAKTIEMISEKVDEPFINQQHLDELEQLRTHIDEETGIKAT
                    ************************************************************

    COL             HEEGILHPVEIIESMQKVLTDDTTVTVDVGSHYIWMARNFRSYNPRHLLFSNGMQTLGVA
    N315            HEEGILHPVEIIESMQKVLTDDTTVTVDVGSHYIWMARNFRSYNPRHLLFSNGMQTLGVA
    NCTC8325        HEEGILHPVEIIESMQKVLTDDTTVTVDVGSHYIWMARNFRSYNPRHLLFSNGMQTLGVA
    Newman          HEEGILHPVEIIESMQKVLTDDTTVTVDVGSHYIWMARNFRSYNPRHLLFSNGMQTLGVA
    USA300_FPR3757  HEEGILHPVEIIESMQKVLTDDTTVTVDVGSHYIWMARNFRSYNPRHLLFSNGMQTLGVA
                    ************************************************************

    COL             LPWAISAALVRPNTQVVSVAGDGGFLFSSQDLETAVRKNLNIIQLIWNDGKYNMVEFQEE
    N315            LPWAISAALVRPNTQVVSVAGDGGFLFSSQDLETAVRKNLNIIQLIWNDGKYNMVEFQEE
    NCTC8325        LPWAISAALVRPNTQVVSVAGDGGFLFSSQDLETAVRKNLNIIQLIWNDGKYNMVEFQEE
    Newman          LPWAISAALVRPNTQVVSVAGDGGFLFSSQDLETAVRKNLNIIQLIWNDGKYNMVEFQEE
    USA300_FPR3757  LPWAISAALVRPNTQVVSVAGDGGFLFSSQDLETAVRKNLNIIQLIWNDGKYNMVEFQEE
                    ************************************************************

    COL             MKYKRSSGVDFGPVDFVKYAESFGAKGLRVTNQEELEAAIKEGYETDGPVLIDIPVNYKD
    N315            MKYKRSSGVDFGPVDFVKYAESFGAKGLRVTNQEELEAAIKEGYETDGPVLIDIPVNYKD
    NCTC8325        MKYKRSSGVDFGPVDFVKYAESFGAKGLRVTNQEELEAAIKEGYETDGPVLIDIPVNYKD
    Newman          MKYKRSSGVDFGPVDFVKYAESFGAKGLRVTNQEELEAAIKEGYETDGPVLIDIPVNYKD
    USA300_FPR3757  MKYKRSSGVDFGPVDFVKYAESFGAKGLRVTNQEELEAAIKEGYETDGPVLIDIPVNYKD
                    ************************************************************

    COL             NIKLSTNMLPDVFN
    N315            NIKLSTNMLPDVFN
    NCTC8325        NIKLSTNMLPDVFN
    Newman          NIKLSTNMLPDVFN
    USA300_FPR3757  NIKLSTNMLPDVFN
                    **************