From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005667000
  • symbol?: rplM
  • description?: 50S ribosomal protein L13
  • strand?: -
  • coordinates?: 5791142..5791583
  • synteny block?: BlockID0044140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2207 (rplM)
    N315:
    SA2017 (rplM)
    NCTC8325:
    Newman:
    NWMN_2120 (rplM)
    USA300_FPR3757:
    04-02981:
    SA2981_2156 (rplM)
    08BA02176:
    C248_2254 (rplM)
    11819-97:
    MS7_2238 (rplM)
    71193:
    ST398NM01_2271
    ECT-R 2:
    ECTR2_2080 (rplM)
    ED133:
    SAOV_2256c
    ED98:
    SAAV_2279 (rplM)
    HO 5096 0412:
    SAEMRSA15_21170 (rplM)
    JH1:
    SaurJH1_2286 (rplM)
    JH9:
    SaurJH9_2245 (rplM)
    JKD6008:
    SAA6008_02255 (rplM)
    JKD6159:
    SAA6159_02125 (rplM)
    LGA251:
    SARLGA251_20040 (rplM)
    M013:
    M013TW_2178
    MRSA252:
    SAR2301 (rplM)
    MSHR1132:
    SAMSHR1132_20440
    MSSA476:
    SAS2109 (rplM)
    Mu3:
    SAHV_2202 (rplM)
    Mu50:
    SAV2218 (rplM)
    MW2:
    MW2137 (rplM)
    RF122:
    SAB2091c (rplM)
    ST398:
    SAPIG2271 (rplM)
    T0131:
    SAT0131_02390
    TCH60:
    HMPREF0772_10980 (rplM)
    TW20:
    SATW20_23520 (rplM)
    USA300_TCH1516:
    USA300HOU_2209 (rplM)
    VC40:
    SAVC_09960 (rplM)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINA
    N315            MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINA
    NCTC8325        MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINA
    Newman          MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINA
    USA300_FPR3757  MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINA
                    ************************************************************

    COL             SKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQG
    N315            SKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQG
    NCTC8325        SKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQG
    Newman          SKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQG
    USA300_FPR3757  SKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQG
                    ************************************************************

    COL             KKLFVYGGAEHPHAAQQPENYELRG
    N315            KKLFVYGGAEHPHAAQQPENYELRG
    NCTC8325        KKLFVYGGAEHPHAAQQPENYELRG
    Newman          KKLFVYGGAEHPHAAQQPENYELRG
    USA300_FPR3757  KKLFVYGGAEHPHAAQQPENYELRG
                    *************************