From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005675000
  • symbol?: rplQ
  • description?: 50S ribosomal protein L17
  • strand?: -
  • coordinates?: 5797398..5797766
  • synteny block?: BlockID0044210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2212 (rplQ)
    N315:
    SA2022 (rplQ)
    NCTC8325:
    Newman:
    NWMN_2125 (rplQ)
    USA300_FPR3757:
    04-02981:
    SA2981_2161 (rplQ)
    08BA02176:
    C248_2259 (rplQ)
    11819-97:
    MS7_2243 (rplQ)
    71193:
    ST398NM01_2276
    ECT-R 2:
    ECTR2_2085 (rplQ)
    ED133:
    SAOV_2261c
    ED98:
    SAAV_2285 (rplQ)
    HO 5096 0412:
    SAEMRSA15_21220 (rplQ)
    JH1:
    SaurJH1_2291 (rplQ)
    JH9:
    SaurJH9_2250 (rplQ)
    JKD6008:
    SAA6008_02260 (rplQ)
    JKD6159:
    SAA6159_02130 (rplQ)
    LGA251:
    SARLGA251_20090 (rplQ)
    M013:
    M013TW_2183
    MRSA252:
    SAR2308 (rplQ)
    MSHR1132:
    SAMSHR1132_20490
    MSSA476:
    SAS2114 (rplQ)
    Mu3:
    SAHV_2207 (rplQ)
    Mu50:
    SAV2223 (rplQ)
    MW2:
    MW2142 (rplQ)
    RF122:
    SAB2096c (rplQ)
    ST398:
    SAPIG2276 (rplQ)
    T0131:
    SAT0131_02396
    TCH60:
    HMPREF0772_10975 (rplQ)
    TW20:
    SATW20_23570 (rplQ)
    USA300_TCH1516:
    USA300HOU_2214 (rplQ)
    VC40:
    SAVC_09985 (rplQ)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGYRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRR
    N315            MGYRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRR
    NCTC8325        MGYRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRR
    Newman          MGYRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRR
    USA300_FPR3757  MGYRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRR
                    ************************************************************

    COL             NAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIE
    N315            NAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIE
    NCTC8325        NAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIE
    Newman          NAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIE
    USA300_FPR3757  NAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIE
                    ************************************************************

    COL             LV
    N315            LV
    NCTC8325        LV
    Newman          LV
    USA300_FPR3757  LV
                    **