From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005676000
  • symbol?: rpoA
  • description?: DNA-directed RNA polymerase subunit alpha

      descriptions from strain specific annotations:

    • DNA-directed RNA polymerase subunit alpha
    • DNA-directed RNA polymerase alpha subunit
    • DNA-directed RNA polymerase, alpha subunit
  • strand?: -
  • coordinates?: 5797783..5798727
  • synteny block?: BlockID0044220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2213 (rpoA)
    N315:
    SA2023 (rpoA)
    NCTC8325:
    Newman:
    NWMN_2126 (rpoA)
    USA300_FPR3757:
    04-02981:
    SA2981_2162 (rpoA)
    08BA02176:
    C248_2260 (rpoA)
    11819-97:
    MS7_2244 (rpoA)
    71193:
    ST398NM01_2277
    ECT-R 2:
    ECTR2_2086 (rpoA)
    ED133:
    SAOV_2262c
    ED98:
    SAAV_2286 (rpoA)
    HO 5096 0412:
    SAEMRSA15_21230 (rpoA)
    JH1:
    SaurJH1_2292
    JH9:
    SaurJH9_2251
    JKD6008:
    SAA6008_02261 (rpoA)
    JKD6159:
    SAA6159_02131 (rpoA)
    LGA251:
    SARLGA251_20100 (rpoA)
    M013:
    M013TW_2184
    MRSA252:
    SAR2309 (rpoA)
    MSHR1132:
    SAMSHR1132_20500
    MSSA476:
    SAS2115
    Mu3:
    SAHV_2208 (rpoA)
    Mu50:
    SAV2224 (rpoA)
    MW2:
    MW2143 (rpoA)
    RF122:
    SAB2097c (rpoA)
    ST398:
    SAPIG2277 (rpoA)
    T0131:
    SAT0131_02397
    TCH60:
    HMPREF0772_10974 (rpoA)
    TW20:
    SATW20_23580 (rpoA)
    USA300_TCH1516:
    USA300HOU_2215 (rpoA)
    VC40:
    SAVC_09990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIEIEKPRIETIEISEDAKFGKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVKYIEIEG
    N315            MIEIEKPRIETIEISEDAKFGKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVKYIEIEG
    NCTC8325        MIEIEKPRIETIEISEDAKFGKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVKYIEIEG
    Newman          MIEIEKPRIETIEISEDAKFGKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVKYIEIEG
    USA300_FPR3757  MIEIEKPRIETIEISEDAKFGKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVKYIEIEG
                    ************************************************************

    COL             VLHEFSAVDNVVEDVSTIIMNIKQLALKIYSEEDKTLEIDVRDEGEVTASDITHDSDVEI
    N315            VLHEFSAVDNVVEDVSTIIMNIKQLALKIYSEEDKTLEIDVRDEGEVTASDITHDSDVEI
    NCTC8325        VLHEFSAVDNVVEDVSTIIMNIKQLALKIYSEEDKTLEIDVRDEGEVTASDITHDSDVEI
    Newman          VLHEFSAVDNVVEDVSTIIMNIKQLALKIYSEEDKTLEIDVRDEGEVTASDITHDSDVEI
    USA300_FPR3757  VLHEFSAVDNVVEDVSTIIMNIKQLALKIYSEEDKTLEIDVRDEGEVTASDITHDSDVEI
                    ************************************************************

    COL             LNPELKIATVSKGGHLKIRLVANKGRGYALAEQNNTSDLPIGVIPVDSLYSPVERVNYTV
    N315            LNPELKIATVSKGGHLKIRLVANKGRGYALAEQNNTSDLPIGVIPVDSLYSPVERVNYTV
    NCTC8325        LNPELKIATVSKGGHLKIRLVANKGRGYALAEQNNTSDLPIGVIPVDSLYSPVERVNYTV
    Newman          LNPELKIATVSKGGHLKIRLVANKGRGYALAEQNNTSDLPIGVIPVDSLYSPVERVNYTV
    USA300_FPR3757  LNPELKIATVSKGGHLKIRLVANKGRGYALAEQNNTSDLPIGVIPVDSLYSPVERVNYTV
                    ************************************************************

    COL             ENTRVGQSSDFDKLTLDVWTNGSITPQESVSLAAKIMTEHLNIFVGLTDEAQNAEIMIEK
    N315            ENTRVGQSSDFDKLTLDVWTNGSITPQESVSLAAKIMTEHLNIFVGLTDEAQNAEIMIEK
    NCTC8325        ENTRVGQSSDFDKLTLDVWTNGSITPQESVSLAAKIMTEHLNIFVGLTDEAQNAEIMIEK
    Newman          ENTRVGQSSDFDKLTLDVWTNGSITPQESVSLAAKIMTEHLNIFVGLTDEAQNAEIMIEK
    USA300_FPR3757  ENTRVGQSSDFDKLTLDVWTNGSITPQESVSLAAKIMTEHLNIFVGLTDEAQNAEIMIEK
                    ************************************************************

    COL             EEDQKEKVLEMSIEELDLSVRSYNCLKRAGINSVQELADKSEADMMKVRNLGRKSLEEVK
    N315            EEDQKEKVLEMSIEELDLSVRSYNCLKRAGINSVQELADKSEADMMKVRNLGRKSLEEVK
    NCTC8325        EEDQKEKVLEMSIEELDLSVRSYNCLKRAGINSVQELADKSEADMMKVRNLGRKSLEEVK
    Newman          EEDQKEKVLEMSIEELDLSVRSYNCLKRAGINSVQELADKSEADMMKVRNLGRKSLEEVK
    USA300_FPR3757  EEDQKEKVLEMSIEELDLSVRSYNCLKRAGINSVQELADKSEADMMKVRNLGRKSLEEVK
                    ************************************************************

    COL             YKLEDLGLGLRKED
    N315            YKLEDLGLGLRKED
    NCTC8325        YKLEDLGLGLRKED
    Newman          YKLEDLGLGLRKED
    USA300_FPR3757  YKLEDLGLGLRKED
                    **************