From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005678000
  • symbol?: rpsM
  • description?: 30S ribosomal protein S13

      descriptions from strain specific annotations:

    • 30S ribosomal protein S13
    • ribosomal protein S13p/S18e
  • strand?: -
  • coordinates?: 5799215..5799580
  • synteny block?: BlockID0044240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2215 (rpsM)
    N315:
    SA2025 (rpsM)
    NCTC8325:
    Newman:
    NWMN_2128 (rpsM)
    USA300_FPR3757:
    04-02981:
    SA2981_2164 (rpsM)
    08BA02176:
    C248_2262 (rpsM)
    11819-97:
    MS7_2246 (rpsM)
    71193:
    ST398NM01_2279
    ECT-R 2:
    ECTR2_2088
    ED133:
    SAOV_2264c
    ED98:
    SAAV_2288 (rpsM)
    HO 5096 0412:
    SAEMRSA15_21250 (rpsM)
    JH1:
    SaurJH1_2294 (rpsM)
    JH9:
    SaurJH9_2253 (rpsM)
    JKD6008:
    SAA6008_02263 (rpsM)
    JKD6159:
    SAA6159_02133 (rpsM)
    LGA251:
    SARLGA251_20120 (rpsM)
    M013:
    M013TW_2186
    MRSA252:
    SAR2311 (rpsM)
    MSHR1132:
    SAMSHR1132_20520
    MSSA476:
    SAS2117 (rpsM)
    Mu3:
    SAHV_2210 (rpsM)
    Mu50:
    SAV2226 (rpsM)
    MW2:
    MW2145 (rpsM)
    RF122:
    SAB2099c (rpsM)
    ST398:
    SAPIG2279 (rpsM)
    T0131:
    SAT0131_02399
    TCH60:
    HMPREF0772_10972 (rpsM)
    TW20:
    SATW20_23600 (rpsM)
    USA300_TCH1516:
    USA300HOU_2217 (rpsM)
    VC40:
    SAVC_10000 (rpsM)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MARIAGVDIPREKRVVISLTYIYGIGTSTAQKILEEANVSADTRVKDLTDDELGRIREVV
    N315            MARIAGVDIPREKRVVISLTYIYGIGTSTAQKILEEANVSADTRVKDLTDDELGRIREVV
    NCTC8325        MARIAGVDIPREKRVVISLTYIYGIGTSTAQKILEEANVSADTRVKDLTDDELGRIREVV
    Newman          MARIAGVDIPREKRVVISLTYIYGIGTSTAQKILEEANVSADTRVKDLTDDELGRIREVV
    USA300_FPR3757  MARIAGVDIPREKRVVISLTYIYGIGTSTAQKILEEANVSADTRVKDLTDDELGRIREVV
                    ************************************************************

    COL             DGYKVEGDLRRETNLNIKRLMEISSYRGIRHRRGLPVRGQKTKNNARTRKGPVKTVANKK
    N315            DGYKVEGDLRRETNLNIKRLMEISSYRGIRHRRGLPVRGQKTKNNARTRKGPVKTVANKK
    NCTC8325        DGYKVEGDLRRETNLNIKRLMEISSYRGIRHRRGLPVRGQKTKNNARTRKGPVKTVANKK
    Newman          DGYKVEGDLRRETNLNIKRLMEISSYRGIRHRRGLPVRGQKTKNNARTRKGPVKTVANKK
    USA300_FPR3757  DGYKVEGDLRRETNLNIKRLMEISSYRGIRHRRGLPVRGQKTKNNARTRKGPVKTVANKK
                    ************************************************************

    COL             K
    N315            K
    NCTC8325        K
    Newman          K
    USA300_FPR3757  K
                    *