From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005679000
  • symbol?: rpmJ
  • description?: 50S ribosomal protein L36
  • strand?: -
  • coordinates?: 5799603..5799716
  • synteny block?: BlockID0044250
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2216 (rpmJ)
    N315:
    SAS078 (rpmJ)
    NCTC8325:
    Newman:
    NWMN_2129 (rpmJ)
    USA300_FPR3757:
    04-02981:
    SA2981_2165 (rpmJ)
    08BA02176:
    C248_2263 (rpmJ)
    11819-97:
    MS7_2247 (rpmJ)
    71193:
    ST398NM01_2280
    ECT-R 2:
    ECTR2_2089 (rpmJ)
    ED133:
    ED98:
    SAAV_2289 (rpmJ)
    HO 5096 0412:
    SAEMRSA15_21260 (rpmJ)
    JH1:
    SaurJH1_2295 (rpmJ)
    JH9:
    SaurJH9_2254 (rpmJ)
    JKD6008:
    SAA6008_02264 (rpmJ)
    JKD6159:
    SAA6159_02134 (rpmJ)
    LGA251:
    SARLGA251_20130 (rpmJ)
    M013:
    M013TW_2187
    MRSA252:
    SAR2312 (rpmJ)
    MSHR1132:
    SAMSHR1132_20530
    MSSA476:
    SAS2118 (rpmJ)
    Mu3:
    SAHV_2211 (rpmJ)
    Mu50:
    SAV2227 (rpmJ)
    MW2:
    MW2146 (rpmJ)
    RF122:
    ST398:
    SAPIG2280 (rpmJ)
    T0131:
    SAT0131_02400
    TCH60:
    HMPREF0772_10971 (rpmJ)
    TW20:
    SATW20_23610 (rpmJ)
    USA300_TCH1516:
    USA300HOU_2218 (rpmJ)
    VC40:
    SAVC_10005 (rpmJ)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
    N315            MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
    NCTC8325        MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
    Newman          MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
    USA300_FPR3757  MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
                    *************************************