From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005680000
  • symbol?: infA
  • description?: translation initiation factor IF-1

      descriptions from strain specific annotations:

    • translation initiation factor IF-1
    • protein translation initiation factor 1 (IF-1)
    • translation initiation factor 1
  • strand?: -
  • coordinates?: 5799748..5799966
  • synteny block?: BlockID0044260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2217 (infA)
    N315:
    SA2026 (infA)
    NCTC8325:
    Newman:
    NWMN_2130 (infA)
    USA300_FPR3757:
    04-02981:
    SA2981_2166 (infA)
    08BA02176:
    C248_2264 (infA)
    11819-97:
    MS7_2248 (infA)
    71193:
    ST398NM01_2281
    ECT-R 2:
    ECTR2_2090 (infA)
    ED133:
    SAOV_2265c
    ED98:
    SAAV_2290 (infA)
    HO 5096 0412:
    SAEMRSA15_21270 (infA)
    JH1:
    SaurJH1_2296 (infA)
    JH9:
    SaurJH9_2255 (infA)
    JKD6008:
    SAA6008_02265 (infA)
    JKD6159:
    SAA6159_02135 (infA)
    LGA251:
    SARLGA251_20140 (infA)
    M013:
    M013TW_2188
    MRSA252:
    SAR2313 (infA)
    MSHR1132:
    SAMSHR1132_20540
    MSSA476:
    SAS2119 (infA)
    Mu3:
    SAHV_2212 (infA)
    Mu50:
    SAV2228 (infA)
    MW2:
    MW2147 (infA)
    RF122:
    SAB2100c (infA)
    ST398:
    SAPIG2281 (infA)
    T0131:
    SAT0131_02401 (cydA)
    TCH60:
    HMPREF0772_10970 (infA)
    TW20:
    SATW20_23620 (infA)
    USA300_TCH1516:
    USA300HOU_2219 (infA)
    VC40:
    SAVC_10010 (infA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPY
    N315            MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPY
    NCTC8325        MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPY
    Newman          MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPY
    USA300_FPR3757  MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPY
                    ************************************************************

    COL             DLTRGRITYRYK
    N315            DLTRGRITYRYK
    NCTC8325        DLTRGRITYRYK
    Newman          DLTRGRITYRYK
    USA300_FPR3757  DLTRGRITYRYK
                    ************