From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005681000
  • symbol?: adk
  • description?: adenylate kinase

      descriptions from strain specific annotations:

    • adenylate kinase
    • adenylate kinase (ATP-AMP transphosphorylase) (AK)(Superoxide-inducible protein 16) (SOI16)
    • Nucleoside-triphosphate--adenylate kinase
  • strand?: -
  • coordinates?: 5800159..5800806
  • synteny block?: BlockID0044270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2218 (adk)
    N315:
    SA2027 (adk)
    NCTC8325:
    Newman:
    NWMN_2131 (adk)
    USA300_FPR3757:
    04-02981:
    SA2981_2167 (adk)
    08BA02176:
    C248_2265 (adk)
    11819-97:
    MS7_2249 (adk)
    71193:
    ST398NM01_2282
    ECT-R 2:
    ECTR2_2091
    ED133:
    SAOV_2266c
    ED98:
    SAAV_2291 (adk)
    HO 5096 0412:
    SAEMRSA15_21280 (adk)
    JH1:
    SaurJH1_2297 (adk)
    JH9:
    SaurJH9_2256 (adk)
    JKD6008:
    SAA6008_02266 (adk)
    JKD6159:
    SAA6159_02136 (adk)
    LGA251:
    SARLGA251_20150 (adk)
    M013:
    M013TW_2189
    MRSA252:
    SAR2314 (adk)
    MSHR1132:
    SAMSHR1132_20550
    MSSA476:
    SAS2120 (adk)
    Mu3:
    SAHV_2213 (adk)
    Mu50:
    SAV2229 (adk)
    MW2:
    MW2148 (adk)
    RF122:
    SAB2101c (adk)
    ST398:
    SAPIG2282
    T0131:
    SAT0131_02402 (cydB)
    TCH60:
    HMPREF0772_10969 (adk)
    TW20:
    SATW20_23630 (adk)
    USA300_TCH1516:
    USA300HOU_2220 (adk)
    VC40:
    SAVC_10015 (adk)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIILMGLPGAGKGTQASEIVKKFPIPHISTGDMFRKAIKEETELGKEAKSYMDRGELVP
    N315            MNIILMGLPGAGKGTQASEIVKKFPIPHISTGDMFRKAIKEETELGKEAKSYMDRGELVP
    NCTC8325        MNIILMGLPGAGKGTQASEIVKKFPIPHISTGDMFRKAIKEETELGKEAKSYMDRGELVP
    Newman          MNIILMGLPGAGKGTQASEIVKKFPIPHISTGDMFRKAIKEETELGKEAKSYMDRGELVP
    USA300_FPR3757  MNIILMGLPGAGKGTQASEIVKKFPIPHISTGDMFRKAIKEETELGKEAKSYMDRGELVP
                    ************************************************************

    COL             DEVTVGIVKERISEDDAKKGFLLDGFPRTIEQAEALNNIMSELDRNIDAVINIEVPEEEL
    N315            DEVTVGIVKERISEDDAKKGFLLDGFPRTIEQAEALNNIMSELDRNIDAVINIEVPEEEL
    NCTC8325        DEVTVGIVKERISEDDAKKGFLLDGFPRTIEQAEALNNIMSELDRNIDAVINIEVPEEEL
    Newman          DEVTVGIVKERISEDDAKKGFLLDGFPRTIEQAEALNNIMSELDRNIDAVINIEVPEEEL
    USA300_FPR3757  DEVTVGIVKERISEDDAKKGFLLDGFPRTIEQAEALNNIMSELDRNIDAVINIEVPEEEL
                    ************************************************************

    COL             MNRLTGRRICESCGTTYHLVFNPPKVEGICDIDGGKLYQREDDNPETVANRLSVNIKQSK
    N315            MNRLTGRRICESCGTTYHLVFNPPKVEGICDIDGGKLYQREDDNPETVANRLSVNIKQSK
    NCTC8325        MNRLTGRRICESCGTTYHLVFNPPKVEGICDIDGGKLYQREDDNPETVANRLSVNIKQSK
    Newman          MNRLTGRRICESCGTTYHLVFNPPKVEGICDIDGGKLYQREDDNPETVANRLSVNIKQSK
    USA300_FPR3757  MNRLTGRRICESCGTTYHLVFNPPKVEGICDIDGGKLYQREDDNPETVANRLSVNIKQSK
                    ************************************************************

    COL             PILDFYDQKGVLKNIDGSKDISDVTKDVIDILDHL
    N315            PILDFYDQKGVLKNIDGSKDISDVTKDVIDILDHL
    NCTC8325        PILDFYDQKGVLKNIDGSKDISDVTKDVIDILDHL
    Newman          PILDFYDQKGVLKNIDGSKDISDVTKDVIDILDHL
    USA300_FPR3757  PILDFYDQKGVLKNIDGSKDISDVTKDVIDILDHL
                    ***********************************