From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005683000
  • symbol?: rplO
  • description?: 50S ribosomal protein L15
  • strand?: -
  • coordinates?: 5802168..5802608
  • synteny block?: BlockID0044290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2220 (rplO)
    N315:
    SA2029 (rplO)
    NCTC8325:
    Newman:
    NWMN_2133 (rplO)
    USA300_FPR3757:
    04-02981:
    SA2981_2169 (rplO)
    08BA02176:
    C248_2267 (rplO)
    11819-97:
    MS7_2251 (rplO)
    71193:
    ST398NM01_2284
    ECT-R 2:
    ECTR2_2093 (rplO)
    ED133:
    SAOV_2268c
    ED98:
    SAAV_2293 (rplO)
    HO 5096 0412:
    SAEMRSA15_21300 (rplO)
    JH1:
    SaurJH1_2299 (rplO)
    JH9:
    SaurJH9_2258 (rplO)
    JKD6008:
    SAA6008_02268 (rplO)
    JKD6159:
    SAA6159_02138 (rplO)
    LGA251:
    SARLGA251_20170 (rplO)
    M013:
    M013TW_2191
    MRSA252:
    SAR2316 (rplO)
    MSHR1132:
    SAMSHR1132_20570
    MSSA476:
    SAS2122 (rplO)
    Mu3:
    SAHV_2215 (rplO)
    Mu50:
    SAV2231 (rplO)
    MW2:
    MW2150 (rplO)
    RF122:
    SAB2103c (rplO)
    ST398:
    SAPIG2284 (rplO)
    T0131:
    SAT0131_02404
    TCH60:
    HMPREF0772_10967 (rplO)
    TW20:
    SATW20_23650 (rplO)
    USA300_TCH1516:
    USA300HOU_2222 (rplO)
    VC40:
    SAVC_10025 (rplO)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRR
    N315            MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRR
    NCTC8325        MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRR
    Newman          MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRR
    USA300_FPR3757  MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRR
                    ************************************************************

    COL             LPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKK
    N315            LPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKK
    NCTC8325        LPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKK
    Newman          LPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKK
    USA300_FPR3757  LPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKK
                    ************************************************************

    COL             LTVKAHKFSASAAEAIDAKGGAHEVI
    N315            LTVKAHKFSASAAEAIDAKGGAHEVI
    NCTC8325        LTVKAHKFSASAAEAIDAKGGAHEVI
    Newman          LTVKAHKFSASAAEAIDAKGGAHEVI
    USA300_FPR3757  LTVKAHKFSASAAEAIDAKGGAHEVI
                    **************************