From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005688000
  • symbol?: rpsH
  • description?: 30S ribosomal protein S8

      descriptions from strain specific annotations:

    • 30S ribosomal protein S8
    • 30S ribosomal protein S8 (BS8)
  • strand?: -
  • coordinates?: 5804294..5804692
  • synteny block?: BlockID0044340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2225 (rpsH)
    N315:
    SA2034 (rpsH)
    NCTC8325:
    Newman:
    NWMN_2138 (rpsH)
    USA300_FPR3757:
    04-02981:
    SA2981_2174 (rpsH)
    08BA02176:
    C248_2272 (rpsH)
    11819-97:
    MS7_2256 (rpsH)
    71193:
    ST398NM01_2289
    ECT-R 2:
    ECTR2_2098
    ED133:
    SAOV_2273c
    ED98:
    SAAV_2298 (rpsH)
    HO 5096 0412:
    SAEMRSA15_21350 (rpsH)
    JH1:
    SaurJH1_2304 (rpsH)
    JH9:
    SaurJH9_2263 (rpsH)
    JKD6008:
    SAA6008_02273 (rpsH)
    JKD6159:
    SAA6159_02143 (rpsH)
    LGA251:
    SARLGA251_20220 (rpsH)
    M013:
    M013TW_2196
    MRSA252:
    SAR2321 (rpsH)
    MSHR1132:
    SAMSHR1132_20620
    MSSA476:
    SAS2127 (rpsH)
    Mu3:
    SAHV_2220 (rpsH)
    Mu50:
    SAV2236 (rpsH)
    MW2:
    MW2155 (rpsH)
    RF122:
    SAB2108c (rpsH)
    ST398:
    SAPIG2289 (rpsH)
    T0131:
    SAT0131_02409
    TCH60:
    HMPREF0772_10962 (rpsH)
    TW20:
    SATW20_23700 (rpsH)
    USA300_TCH1516:
    USA300HOU_2227 (rpsH)
    VC40:
    SAVC_10050 (rpsH)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEYVEDDKQGVL
    N315            MTMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEYVEDDKQGVL
    NCTC8325        MTMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEYVEDDKQGVL
    Newman          MTMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEYVEDDKQGVL
    USA300_FPR3757  MTMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEYVEDDKQGVL
                    ************************************************************

    COL             RLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGLGIALVSTSEGVITDKEARK
    N315            RLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGLGIALVSTSEGVITDKEARK
    NCTC8325        RLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGLGIALVSTSEGVITDKEARK
    Newman          RLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGLGIALVSTSEGVITDKEARK
    USA300_FPR3757  RLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGLGIALVSTSEGVITDKEARK
                    ************************************************************

    COL             RNVGGEIIAYVW
    N315            RNVGGEIIAYVW
    NCTC8325        RNVGGEIIAYVW
    Newman          RNVGGEIIAYVW
    USA300_FPR3757  RNVGGEIIAYVW
                    ************