From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005691000
  • symbol?: rplX
  • description?: 50S ribosomal protein L24

      descriptions from strain specific annotations:

    • 50S ribosomal protein L24
    • 50S ribosomal protein L24p (L26e)
  • strand?: -
  • coordinates?: 5805498..5805815
  • synteny block?: BlockID0044370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2228 (rplX)
    N315:
    SA2036 (rplX)
    NCTC8325:
    Newman:
    NWMN_2141 (rplX)
    USA300_FPR3757:
    04-02981:
    SA2981_2177 (rplX)
    08BA02176:
    C248_2275 (rplX)
    11819-97:
    MS7_2259 (rplX)
    71193:
    ST398NM01_2292
    ECT-R 2:
    ECTR2_2101 (rplX)
    ED133:
    SAOV_2276c
    ED98:
    SAAV_2301 (rplX)
    HO 5096 0412:
    SAEMRSA15_21380 (rplX)
    JH1:
    SaurJH1_2307 (rplX)
    JH9:
    SaurJH9_2266 (rplX)
    JKD6008:
    SAA6008_02276 (rplX)
    JKD6159:
    SAA6159_02146 (rplX)
    LGA251:
    SARLGA251_20250 (rplX)
    M013:
    M013TW_2198
    MRSA252:
    SAR2324 (rplX)
    MSHR1132:
    SAMSHR1132_20650
    MSSA476:
    SAS2130 (rplX)
    Mu3:
    SAHV_2223 (rplX)
    Mu50:
    SAV2239 (rplX)
    MW2:
    MW2158 (rplX)
    RF122:
    SAB2111c (rplX)
    ST398:
    SAPIG2292 (rplX)
    T0131:
    SAT0131_02412
    TCH60:
    HMPREF0772_10959 (rplX)
    TW20:
    SATW20_23730 (rplX)
    USA300_TCH1516:
    USA300HOU_2230 (rplX)
    VC40:
    SAVC_10065 (rplX)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETE
    N315            MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETE
    NCTC8325        MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETE
    Newman          MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETE
    USA300_FPR3757  MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETE
                    ************************************************************

    COL             AAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN
    N315            AAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN
    NCTC8325        AAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN
    Newman          AAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN
    USA300_FPR3757  AAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN
                    *********************************************