From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005692000
  • symbol?: rplN
  • description?: 50S ribosomal protein L14
  • strand?: -
  • coordinates?: 5805851..5806219
  • synteny block?: BlockID0044380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2229 (rplN)
    N315:
    SA2037 (rplN)
    NCTC8325:
    Newman:
    NWMN_2142 (rplN)
    USA300_FPR3757:
    04-02981:
    SA2981_2178 (rplN)
    08BA02176:
    C248_2276 (rplN)
    11819-97:
    MS7_2260 (rplN)
    71193:
    ST398NM01_2293
    ECT-R 2:
    ECTR2_2102 (rplN)
    ED133:
    SAOV_2277c
    ED98:
    SAAV_2302 (rplN)
    HO 5096 0412:
    SAEMRSA15_21390 (rplN)
    JH1:
    SaurJH1_2308 (rplN)
    JH9:
    SaurJH9_2267 (rplN)
    JKD6008:
    SAA6008_02277 (rplN)
    JKD6159:
    SAA6159_02147 (rplN)
    LGA251:
    SARLGA251_20260 (rplN)
    M013:
    M013TW_2199
    MRSA252:
    SAR2325 (rplN)
    MSHR1132:
    SAMSHR1132_20660
    MSSA476:
    SAS2131 (rplN)
    Mu3:
    SAHV_2224 (rplN)
    Mu50:
    SAV2240 (rplN)
    MW2:
    MW2159 (rplN)
    RF122:
    SAB2112c (rplN)
    ST398:
    SAPIG2293 (rplN)
    T0131:
    SAT0131_02413
    TCH60:
    HMPREF0772_10958 (rplN)
    TW20:
    SATW20_23740 (rplN)
    USA300_TCH1516:
    USA300HOU_2231 (rplN)
    VC40:
    SAVC_10070 (rplN)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKA
    N315            MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKA
    NCTC8325        MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKA
    Newman          MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKA
    USA300_FPR3757  MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKA
                    ************************************************************

    COL             VIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPE
    N315            VIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPE
    NCTC8325        VIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPE
    Newman          VIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPE
    USA300_FPR3757  VIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPE
                    ************************************************************

    COL             VL
    N315            VL
    NCTC8325        VL
    Newman          VL
    USA300_FPR3757  VL
                    **