From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005698000
  • symbol?: rpsS
  • description?: 30S ribosomal protein S19
  • strand?: -
  • coordinates?: 5808233..5808511
  • synteny block?: BlockID0044440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2235 (rpsS)
    N315:
    SA2043 (rpsS)
    NCTC8325:
    Newman:
    NWMN_2148 (rpsS)
    USA300_FPR3757:
    04-02981:
    SA2981_2184 (rpsS)
    08BA02176:
    C248_2282 (rpsS)
    11819-97:
    MS7_2266 (rpsS)
    71193:
    ST398NM01_2299
    ECT-R 2:
    ECTR2_2108 (rpsS)
    ED133:
    SAOV_2283c
    ED98:
    SAAV_2308 (rpsS)
    HO 5096 0412:
    SAEMRSA15_21450 (rpsS)
    JH1:
    SaurJH1_2314 (rpsS)
    JH9:
    SaurJH9_2273 (rpsS)
    JKD6008:
    SAA6008_02283 (rpsS)
    JKD6159:
    SAA6159_02153 (rpsS)
    LGA251:
    SARLGA251_20320 (rpsS)
    M013:
    M013TW_2205
    MRSA252:
    SAR2331 (rpsS)
    MSHR1132:
    SAMSHR1132_20720
    MSSA476:
    SAS2137 (rpsS)
    Mu3:
    SAHV_2230 (rpsS)
    Mu50:
    SAV2246 (rpsS)
    MW2:
    MW2165 (rpsS)
    RF122:
    SAB2118c (rpsS)
    ST398:
    SAPIG2299 (rpsS)
    T0131:
    SAT0131_02419
    TCH60:
    HMPREF0772_10952 (rpsS)
    TW20:
    SATW20_23800 (rpsS)
    USA300_TCH1516:
    USA300HOU_2800
    VC40:
    SAVC_10100 (rpsS)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MARSIKKGPFVDEHLMKKVEAQEGSEKKQVIKTWSRRSTIFPNFIGHTFAVYDGRKHVPV
    N315            MARSIKKGPFVDEHLMKKVEAQEGSEKKQVIKTWSRRSTIFPNFIGHTFAVYDGRKHVPV
    NCTC8325        MARSIKKGPFVDEHLMKKVEAQEGSEKKQVIKTWSRRSTIFPNFIGHTFAVYDGRKHVPV
    Newman          MARSIKKGPFVDEHLMKKVEAQEGSEKKQVIKTWSRRSTIFPNFIGHTFAVYDGRKHVPV
    USA300_FPR3757  MARSIKKGPFVDEHLMKKVEAQEGSEKKQVIKTWSRRSTIFPNFIGHTFAVYDGRKHVPV
                    ************************************************************

    COL             YVTEDMVGHKLGEFAPTRTFKGHVADDKKTRR
    N315            YVTEDMVGHKLGEFAPTRTFKGHVADDKKTRR
    NCTC8325        YVTEDMVGHKLGEFAPTRTFKGHVADDKKTRR
    Newman          YVTEDMVGHKLGEFAPTRTFKGHVADDKKTRR
    USA300_FPR3757  YVTEDMVGHKLGEFAPTRTFKGHVADDKKTRR
                    ********************************