From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005701000
  • symbol?: rplD
  • description?: 50S ribosomal protein L4

      descriptions from strain specific annotations:

    • 50S ribosomal protein L4
    • 50S ribosomal protein L4/L1 family protein
    • 50S ribosomal protein L4P
  • strand?: -
  • coordinates?: 5809719..5810342
  • synteny block?: BlockID0044470
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2238 (rplD)
    N315:
    SA2046 (rplD)
    NCTC8325:
    Newman:
    NWMN_2151 (rplD)
    USA300_FPR3757:
    04-02981:
    SA2981_2187 (rplD)
    08BA02176:
    C248_2285 (rplD)
    11819-97:
    MS7_2269 (rplD)
    71193:
    ST398NM01_2302
    ECT-R 2:
    ECTR2_2111
    ED133:
    SAOV_2286c
    ED98:
    SAAV_2311 (rplD)
    HO 5096 0412:
    SAEMRSA15_21480 (rplD)
    JH1:
    SaurJH1_2317 (rplD)
    JH9:
    SaurJH9_2276 (rplD)
    JKD6008:
    SAA6008_02286 (rplD)
    JKD6159:
    SAA6159_02156 (rplD)
    LGA251:
    SARLGA251_20350 (rplD)
    M013:
    M013TW_2208
    MRSA252:
    SAR2334 (rplD)
    MSHR1132:
    SAMSHR1132_20750
    MSSA476:
    SAS2140 (rplD)
    Mu3:
    SAHV_2233 (rplD)
    Mu50:
    SAV2249 (rplD)
    MW2:
    MW2168 (rplD)
    RF122:
    SAB2121c (rplD)
    ST398:
    SAPIG2302 (rplD)
    T0131:
    SAT0131_02422
    TCH60:
    HMPREF0772_10949 (rplD)
    TW20:
    SATW20_23830 (rplD)
    USA300_TCH1516:
    VC40:
    SAVC_10115 (rplD)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGG
    N315            MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGG
    NCTC8325        MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGG
    Newman          MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGG
    USA300_FPR3757  MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGG
                    ************************************************************

    COL             GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQE
    N315            GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQE
    NCTC8325        GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQE
    Newman          GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQE
    USA300_FPR3757  GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQE
                    ************************************************************

    COL             NGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG
    N315            NGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG
    NCTC8325        NGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG
    Newman          NGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG
    USA300_FPR3757  NGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG
                    ************************************************************

    COL             LNVLDITNADSLVITEAAAKKVEEVLG
    N315            LNVLDITNADSLVITEAAAKKVEEVLG
    NCTC8325        LNVLDITNADSLVITEAAAKKVEEVLG
    Newman          LNVLDITNADSLVITEAAAKKVEEVLG
    USA300_FPR3757  LNVLDITNADSLVITEAAAKKVEEVLG
                    ***************************