From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005702000
  • symbol?: rplC
  • description?: 50S ribosomal protein L3

      descriptions from strain specific annotations:

    • 50S ribosomal protein L3
    • 50S ribosomal protein L3 (BL3)
  • strand?: -
  • coordinates?: 5810369..5811031
  • synteny block?: BlockID0044480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2239 (rplC)
    N315:
    SA2047 (rplC)
    NCTC8325:
    Newman:
    NWMN_2152 (rplC)
    USA300_FPR3757:
    04-02981:
    SA2981_2188 (rplC)
    08BA02176:
    C248_2286 (rplC)
    11819-97:
    MS7_2270 (rplC)
    71193:
    ST398NM01_2303
    ECT-R 2:
    ECTR2_2112
    ED133:
    SAOV_2287c
    ED98:
    SAAV_2312 (rplC)
    HO 5096 0412:
    SAEMRSA15_21490 (rplC)
    JH1:
    SaurJH1_2318 (rplC)
    JH9:
    SaurJH9_2277 (rplC)
    JKD6008:
    SAA6008_02287 (rplC)
    JKD6159:
    SAA6159_02157 (rplC)
    LGA251:
    SARLGA251_20360 (rplC)
    M013:
    M013TW_2209
    MRSA252:
    SAR2335 (rplC)
    MSHR1132:
    SAMSHR1132_20760
    MSSA476:
    SAS2141 (rplC)
    Mu3:
    SAHV_2234 (rplC)
    Mu50:
    SAV2250 (rplC)
    MW2:
    MW2169 (rplC)
    RF122:
    SAB2122c (rplC)
    ST398:
    SAPIG2303 (rplC)
    T0131:
    SAT0131_02423
    TCH60:
    HMPREF0772_10948 (rplC)
    TW20:
    SATW20_23840 (rplC)
    USA300_TCH1516:
    USA300HOU_p4
    VC40:
    SAVC_10120 (rplC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQVGFEDKKAYK
    N315            MTKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQVGFEDKKAYK
    NCTC8325        MTKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQVGFEDKKAYK
    Newman          MTKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQVGFEDKKAYK
    USA300_FPR3757  MTKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQVGFEDKKAYK
                    ************************************************************

    COL             KDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEVGQEVSVDTFVAGDVIDVTG
    N315            KDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEVGQEVSVDTFVAGDVIDVTG
    NCTC8325        KDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEVGQEVSVDTFVAGDVIDVTG
    Newman          KDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEVGQEVSVDTFVAGDVIDVTG
    USA300_FPR3757  KDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEVGQEVSVDTFVAGDVIDVTG
                    ************************************************************

    COL             VSKGKGFQGAIKRHGQSRGPMSHGSHFHRAPGSVGMASDASRVFKGQKMPGRMGGNTVTV
    N315            VSKGKGFQGAIKRHGQSRGPMSHGSHFHRAPGSVGMASDASRVFKGQKMPGRMGGNTVTV
    NCTC8325        VSKGKGFQGAIKRHGQSRGPMSHGSHFHRAPGSVGMASDASRVFKGQKMPGRMGGNTVTV
    Newman          VSKGKGFQGAIKRHGQSRGPMSHGSHFHRAPGSVGMASDASRVFKGQKMPGRMGGNTVTV
    USA300_FPR3757  VSKGKGFQGAIKRHGQSRGPMSHGSHFHRAPGSVGMASDASRVFKGQKMPGRMGGNTVTV
                    ************************************************************

    COL             QNLEVVQVDTENKVILVKGNVPGPKKGLVEIRTSIKKGNK
    N315            QNLEVVQVDTENKVILVKGNVPGPKKGLVEIRTSIKKGNK
    NCTC8325        QNLEVVQVDTENKVILVKGNVPGPKKGLVEIRTSIKKGNK
    Newman          QNLEVVQVDTENKVILVKGNVPGPKKGLVEIRTSIKKGNK
    USA300_FPR3757  QNLEVVQVDTENKVILVKGNVPGPKKGLVEIRTSIKKGNK
                    ****************************************