From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005703000
  • symbol?: rpsJ
  • description?: 30S ribosomal protein S10
  • strand?: -
  • coordinates?: 5811059..5811367
  • synteny block?: BlockID0044490
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2240 (rpsJ)
    N315:
    SA2048 (rpsJ)
    NCTC8325:
    Newman:
    NWMN_2153 (rpsJ)
    USA300_FPR3757:
    04-02981:
    SA2981_2189 (rpsJ)
    08BA02176:
    C248_2287 (rpsJ)
    11819-97:
    MS7_2271 (rpsJ)
    71193:
    ST398NM01_2304
    ECT-R 2:
    ECTR2_2113 (rpsJ)
    ED133:
    SAOV_2288c
    ED98:
    SAAV_2313 (rpsJ)
    HO 5096 0412:
    SAEMRSA15_21500 (rpsJ)
    JH1:
    SaurJH1_2319 (rpsJ)
    JH9:
    SaurJH9_2278 (rpsJ)
    JKD6008:
    SAA6008_02288 (rpsJ)
    JKD6159:
    SAA6159_02158 (rpsJ)
    LGA251:
    SARLGA251_20370 (rpsJ)
    M013:
    M013TW_2210
    MRSA252:
    SAR2336 (rpsJ)
    MSHR1132:
    SAMSHR1132_20770
    MSSA476:
    SAS2142 (rpsJ)
    Mu3:
    SAHV_2235 (rpsJ)
    Mu50:
    SAV2251 (rpsJ)
    MW2:
    MW2170 (rpsJ)
    RF122:
    SAB2123c (rpsJ)
    ST398:
    SAPIG2304 (rpsJ)
    T0131:
    SAT0131_02424 (typA)
    TCH60:
    HMPREF0772_10947 (rpsJ)
    TW20:
    SATW20_23850 (rpsJ)
    USA300_TCH1516:
    VC40:
    SAVC_10125 (rpsJ)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHMYKD
    N315            MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHKYKD
    Newman          MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHKYKD
    USA300_FPR3757  MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHKYKD
                    ******************************************************** ***

    COL             SREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL
    N315            SREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL
    Newman          SREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL
    USA300_FPR3757  SREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL
                    ******************************************