From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005704000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 5811718..5812113
  • synteny block?: BlockID0044500
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2190
    08BA02176:
    C248_2288
    11819-97:
    MS7_2272
    71193:
    ST398NM01_2305
    ECT-R 2:
    ECTR2_2114
    ED133:
    SAOV_2289
    ED98:
    SAAV_2314
    HO 5096 0412:
    SAEMRSA15_21510
    JH1:
    SaurJH1_2320
    JH9:
    SaurJH9_2279
    JKD6008:
    SAA6008_02289
    JKD6159:
    SAA6159_02159
    LGA251:
    SARLGA251_20380
    M013:
    M013TW_2211
    MRSA252:
    SAR2337
    MSHR1132:
    SAMSHR1132_20780
    MSSA476:
    SAS2143
    Mu3:
    SAHV_2236
    Mu50:
    SAV2252
    MW2:
    MW2171
    RF122:
    SAB2124
    ST398:
    SAPIG2305
    T0131:
    SAT0131_02425
    TCH60:
    HMPREF0772_10946
    TW20:
    SATW20_23860
    USA300_TCH1516:
    VC40:
    SAVC_10130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MKNGPKLSLALIGIFLILCEFFYGIPFLGATFILSFGWQPLLFNALLYLILTIILLVN
    N315            --MKNGPKLSLALIGIFLILCEFFYGIPFLGATFILSFGWQPLLFNALLYLILTIILLVN
    NCTC8325        --MKNGPKLSLALIGIFLILCEFFYGIPFLGATFILSFGWQPLLFNALLYLILTIILLVN
    Newman          MNMKNGPKLSLALIGIFLILCEFFYGIPFLGATFILSFGWQPLLFNALLYLILTIILLVN
    USA300_FPR3757  --MKNGPKLSLALIGIFLILCEFFYGIPFLGATFILSFGWQPLLFNALLYLILTIILLVN
                      **********************************************************

    COL             RQNAIRPIAIIPIFGIVGSFLAIIPFLGILIHWILFFLMILFVLVVLSAPTYIPNKNARV
    N315            RQNAIRPIAIIPIFGIVGSFLAIIPFLGILIHWILFFLMILFVLVVLSAPTYIPNKNARV
    NCTC8325        RQNAIRPIAIIPIFGIVGSFLAIIPFLGILIHWILFFLMILFVLVVLSAPTYIPNKNARV
    Newman          RQNAIRPIAIIPIFGIVGSFLAIIPFLGILIHWILFFLMILFVLVVLSAPTYIPNKNARV
    USA300_FPR3757  RQNAIRPIAIIPIFGIVGSFLAIIPFLGILIHWILFFLMILFVLVVLSAPTYIPNKNARV
                    ************************************************************

    COL             IYTQYKDGHRE
    N315            IYTQYKDGHRE
    NCTC8325        IYTQYKDGHRE
    Newman          IYTQYKDGHRE
    USA300_FPR3757  IYTQYKDGHRE
                    ***********