From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005706000
  • symbol?: topB
  • description?: DNA topoisomerase III

      descriptions from strain specific annotations:

    • DNA topoisomerase III
    • DNA topoisomerase III family protein
    • putative DNA topoisomerase
    • DNA topoisomerase 3
    • TopB, DNA topoisomerase III
    • DNA topoisomerase TopB
    • pseudogene
    • DNA topoisomerase 3 (DNA topoisomerase III)
  • strand?: -
  • coordinates?: 5813781..5815916
  • synteny block?: BlockID0044520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2243 (topB)
    N315:
    SA2051 (topB)
    NCTC8325:
    Newman:
    NWMN_2156 (topB)
    USA300_FPR3757:
    04-02981:
    SA2981_2192 (topB)
    08BA02176:
    C248_2290
    11819-97:
    MS7_2274 (topB)
    71193:
    ST398NM01_2307
    ECT-R 2:
    ECTR2_2116 (topB)
    ED133:
    SAOV_2291c
    ED98:
    SAAV_2316 (topB)
    HO 5096 0412:
    SAEMRSA15_21530
    JH1:
    SaurJH1_2322
    JH9:
    SaurJH9_2281
    JKD6008:
    SAA6008_02291 (topB)
    JKD6159:
    SAA6159_02161 (topB)
    LGA251:
    SARLGA251_20400
    M013:
    M013TW_2213
    MRSA252:
    SAR2339
    MSHR1132:
    SAMSHR1132_20800
    MSSA476:
    SAS2145
    Mu3:
    SAHV_2238 (topB)
    Mu50:
    SAV2254 (topB)
    MW2:
    MW2173 (topB)
    RF122:
    SAB2126c
    ST398:
    SAPIG2307
    T0131:
    SAT0131_02427
    TCH60:
    HMPREF0772_10944 (topB)
    TW20:
    SATW20_23880
    USA300_TCH1516:
    USA300HOU_2235 (topB)
    VC40:
    SAVC_10140

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSLILAEKPSVARDIADALQINQKRNGYFENNQYIVTWALGHLVTNATPEQYDKNLKEW
    N315            MKSLILAEKPSVARDIADALQINQKRNGYFENNQYIVTWALGHLVTNATPEQYDKNLKEW
    NCTC8325        MKSLILAEKPSVARDIADALQINQKRNGYFENNQYIVTWALGHLVTNATPEQYDKNLKEW
    Newman          MKSLILAEKPSVARDIADALQINQKRNGYFENNQYIVTWALGHLVTNATPEQYDKNLKEW
    USA300_FPR3757  MKSLILAEKPSVARDIADALQINQKRNGYFENNQYIVTWALGHLVTNATPEQYDKNLKEW
                    ************************************************************

    COL             RLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLILDKV
    N315            RLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLILDKV
    NCTC8325        RLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLILDKV
    Newman          RLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLILDKV
    USA300_FPR3757  RLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLILDKV
                    ************************************************************

    COL             GNKKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINATRALTTK
    N315            GNKKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINATRALTTK
    NCTC8325        GNKKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINATRALTTK
    Newman          GNKKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINATRALTTK
    USA300_FPR3757  GNKKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINATRALTTK
                    ************************************************************

    COL             YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSLTVKGFDFQLESNQRYTNKETLE
    N315            YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSLTVKGFDFQLESNQRYTNKETLE
    NCTC8325        YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSLTVKGFDFQLESNQRYTNKETLE
    Newman          YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSLTVKGFDFQLESNQRYTNKETLE
    USA300_FPR3757  YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSLTVKGFDFQLESNQRYTNKETLE
                    ************************************************************

    COL             QMVNNLKNVDGKIKSVATKHKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERH
    N315            QMVNNLKNVDGKIKSVATKHKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERH
    NCTC8325        QMVNNLKNVDGKIKSVATKHKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERH
    Newman          QMVNNLKNVDGKIKSVATKHKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERH
    USA300_FPR3757  QMVNNLKNVDGKIKSVATKHKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERH
                    ************************************************************

    COL             KVVTYPRTDSNYLTTDMVDTMKERIQATMATTYKDQARPLMSKTFSSKMSIFNNQKVSDH
    N315            KVVTYPRTDSNYLTTDMVDTMKERIQATMATTYKDQARPLMSKTFSSKMSIFNNQKVSDH
    NCTC8325        KVVTYPRTDSNYLTTDMVDTMKERIQVTMATTYKDQARPLMSKTFSSKMSIFNNQKVSDH
    Newman          KVVTYPRTDSNYLTTDMVDTMKERIQATMATTYKDQARPLMSKTFSSKMSIFNNQKVSDH
    USA300_FPR3757  KVVTYPRTDSNYLTTDMVDTMKERIQATMATTYKDQARPLMSKTFSSKMSIFNNQKVSDH
                    **************************.*********************************

    COL             HAIIPTEVRPVMSDLSNRELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENV
    N315            HAIIPTEVRPVMSDLSNRELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENV
    NCTC8325        HAIIPTEVRPVMSDLSNRELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENV
    Newman          HAIIPTEVRPVMSDLSNRELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENV
    USA300_FPR3757  HAIIPTEVRPVMSDLSNRELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENV
                    ************************************************************

    COL             TTVLGFKSIRQGESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQN
    N315            TTVLGFKSIRQGESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQN
    NCTC8325        TTVLGFKSIRQGESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQN
    Newman          TTVLGFKSIRQGESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQN
    USA300_FPR3757  TTVLGFKSIRQGESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQN
                    ************************************************************

    COL             FIQLKDKKYAQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPE
    N315            FIQLKDKKYAQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPE
    NCTC8325        FIQLKDKKYAQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPE
    Newman          FIQLKDKKYAQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPE
    USA300_FPR3757  FIQLKDKKYAQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPE
                    ************************************************************

    COL             ELTSPLLTAQWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTEC
    N315            ELTSPLLTAQWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTEC
    NCTC8325        ELTSPLLTAQWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTEC
    Newman          ELTSPLLTAQWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTEC
    USA300_FPR3757  ELTSPLLTAQWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTEC
                    ************************************************************

    COL             PTCGKFMIKVKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCV
    N315            PTCGKFMIKVKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCV
    NCTC8325        PTCGKFMIKVKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCV
    Newman          PTCGKFMIKVKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCV
    USA300_FPR3757  PTCGKFMIKVKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCV
                    ************************************************************

    COL             CGHSETQAHMDQRMKSKSSGKVSRKEMKKYMNKNEGLDNNPFKDALKNLNL
    N315            CGHSETQAHMDQRMKSKSSGKVSRKEMKKYMNKNEGLDNNPFKDALKNLNL
    NCTC8325        CGHSETQAHMDQRMKSKSSGKVSRKEMKKYMNKNEGLDNNPFKDALKNLNL
    Newman          CGHSETQAHMDQRMKSKSSGKVSRKEMKKYMNKNEGLDNNPFKDALKNLNL
    USA300_FPR3757  CGHSETQAHMDQRMKSKSSGKVSRKEMKKYMNKNEGLDNNPFKDALKNLNL
                    ***************************************************