From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005714000
  • symbol?:
  • description?: malonate transporter

      descriptions from strain specific annotations:

    • malonate transporter
    • AEC family malonate efflux carrier
    • membrane protein
    • membrane transport family protein
    • Permease
    • Transporter
    • transporter, auxin efflux carrier (AEC) family
  • strand?: -
  • coordinates?: 5819091..5819981
  • synteny block?: BlockID0044600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2196
    08BA02176:
    C248_2295
    11819-97:
    MS7_2278
    71193:
    ST398NM01_2310
    ECT-R 2:
    ECTR2_2120
    ED133:
    SAOV_2296c
    ED98:
    SAAV_2320
    HO 5096 0412:
    SAEMRSA15_21560
    JH1:
    SaurJH1_2325
    JH9:
    SaurJH9_2284
    JKD6008:
    SAA6008_02295
    JKD6159:
    SAA6159_02164
    LGA251:
    SARLGA251_20430
    M013:
    M013TW_2216
    MRSA252:
    SAR2342
    MSHR1132:
    SAMSHR1132_20830
    MSSA476:
    SAS2148
    Mu3:
    SAHV_2242
    Mu50:
    SAV2258
    MW2:
    MW2176
    RF122:
    SAB2130c
    ST398:
    SAPIG2310
    T0131:
    SAT0131_02431
    TCH60:
    HMPREF0772_10941
    TW20:
    SATW20_23910
    USA300_TCH1516:
    USA300HOU_2240
    VC40:
    SAVC_10155

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEQFTMIILLIALGYFLKRINFIKATDSQVIATLVLNVTLPSLVIVNLNSAELKLSFSI
    N315            MTEQFTMIILLIALGYFLKRINFIKATDSQVIATLVLNVTLPSLVIVNLNSAELKLSFSI
    NCTC8325        ------MIILLIALGYFLKRINFIKATDSQVIATLVLNVTLPSLVIVNLNSAELKLSFSI
    Newman          MTEQFTMIILLIALGYFLKRINFIKATDSQVIATLVLNVTLPSLVIVNLNSAELKLSFSI
    USA300_FPR3757  ------MIILLIALGYFLKRINFIKATDSQVIATLVLNVTLPSLVIVNLNSAELKLSFSI
                          ******************************************************

    COL             LPILMIIYGIVAKMIAVWFFRKYDNHMRGSVGMMTGAMNIGLFAYPLIEVIWPKTGLIYF
    N315            LPILMIIYGIVAKMIAVWFFRKYDNHMRGSVGMMTGAMNIGLFAYPLIEVIWPKTGLIYF
    NCTC8325        LPILMIIYGIVAKMIAVWFFRKYDNHMRGSVGMMTGAMNIGLFAYPLIEVIWPKTGLIYF
    Newman          LPILMIIYGIVAKMIAVWFFRKYDNHMRGSVGMMTGAMNIGLFAYPLIEVIWPKTGLIYF
    USA300_FPR3757  LPILMIIYGIVAKMIAVWFFRKYDNHMRGSVGMMTGAMNIGLFAYPLIEVIWPKTGLIYF
                    ************************************************************

    COL             VMADIGGAFVMFGITYFVGSYFSEGSDQFDFKYLGKKLLQSVPLVTYIVMFILNISHIHL
    N315            GMADIGGAFVMFGITYFVGSYFSEGSDQFDFKYLGKKLLQSVPLVTYIVMFILNINHIHL
    NCTC8325        VMADIGGAFVMFGITYFVGSYFSEGSDQFDFKYLGKKLLQSVPLVTYIVMFILNISHIHL
    Newman          VMADIGGAFVMFGITYFVGSYFSEGSDQFDFKYLGKKLLQSVPLVTYIVMFILNISHIHL
    USA300_FPR3757  VMADIGGAFVMFGITYFVGSYFSEGSDQFDFKYLGKKLLQSVPLVTYIVMFILNISHIHL
                     ******************************************************.****

    COL             PHVAIDFFSILSHANMPLSMILLGVMLNFTLERKYIPATIKYLCLHYGLALVAGLLVYVL
    N315            PHVAIDFFSILSHANMPLSMILLGVMLNFTLERKYIPATIKYLCLHYGLALVAGLLVHVL
    NCTC8325        PHVAIDFFSILSHANMPLSMILLGVMLNFTLERKYIPATIKYLCLHYGLALVAGLLVYVL
    Newman          PHVAIDFFSILSHANMPLSMILLGVMLNFTLERKYIPATIKYLCLHYGLALVAGLLVYVL
    USA300_FPR3757  PHVAIDFFSILSHANMPLSMILLGVMLNFTLERKYIPATIKYLCLHYGLALVAGLLVYVL
                    *********************************************************:**

    COL             LPVSDDMIKTTLLVTWMFPVGVAIISYGIQFKYRTLPFIGMTTNLTIIISIIILYVYQAV
    N315            LPVSDDMIKTTLLVTWMFPVGVAIISYGIQFKYRTLPFIGMTTNLTIIISIIILYVYQAV
    NCTC8325        LPVSDDMIKTTLLVTWMFPVGVAIISYGIQFKYRTLPFIGMTTNLTIIISIIILYVYQAV
    Newman          LPVSDDMIKTTLLVTWMFPVGVAIISYGIQFKYRTLPFIGMTTNLTIIISIIILYVYQAV
    USA300_FPR3757  LPVSDDMIKTTLLVTWMFPVGVAIISYGIQFKYRTLTFIGMTTNLTIIISIIILYVYQAV
                    ************************************.***********************

    COL             FV
    N315            FV
    NCTC8325        FV
    Newman          FV
    USA300_FPR3757  FV
                    **