From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005717000
  • symbol?:
  • description?: acriflavin resistance protein

      descriptions from strain specific annotations:

    • acriflavin resistance protein
    • RND multidrug efflux transporter
    • acrB/AcrD/AcrF family protein
    • pseudogene
    • export membrane family protein
    • resistance-nodulation-cell division acriflavin:proton (H+) antiporter
    • RND superfamily resistance-nodulation-cell division acriflavin:proton (H+) antiporter
    • acriflavin resistance plasma membrane protein
    • acriflavin resistance transport protein
    • RND multidrug efflux transporter, Acriflavinresistance protein
  • strand?: -
  • coordinates?: 5821178..5824291
  • synteny block?: BlockID0044630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2199
    08BA02176:
    C248_2298
    11819-97:
    MS7_2281
    71193:
    ST398NM01_2313
    ECT-R 2:
    ECTR2_2123
    ED133:
    SAOV_2299c
    ED98:
    SAAV_2323
    HO 5096 0412:
    SAEMRSA15_21590
    JH1:
    SaurJH1_2328
    JH9:
    SaurJH9_2287
    JKD6008:
    SAA6008_02298
    JKD6159:
    SAA6159_02167
    LGA251:
    SARLGA251_20460
    M013:
    M013TW_2219
    MRSA252:
    SAR2345
    MSHR1132:
    SAMSHR1132_20860
    MSSA476:
    SAS2151
    Mu3:
    SAHV_2245
    Mu50:
    SAV2261
    MW2:
    MW2179
    RF122:
    SAB2133c
    ST398:
    SAPIG2313
    T0131:
    SAT0131_02436 (pycA)
    TCH60:
    HMPREF0772_10938
    TW20:
    SATW20_23940
    USA300_TCH1516:
    USA300HOU_2243
    VC40:
    SAVC_10170

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKKLLQFSLGNKFAIFLMVVLVVLGGVYASAKLKLELLPNVQNPVISVTTTMPGATPQS
    N315            MIKKLLQFSLGNKFAIFLMVVLVVLGGVYASAKLKLELLPNVQNPVISVTTTMPGATPQS
    NCTC8325        MIKKLLQFSLGNKFAIFLMVVLVVLGGVYASAKLKLELLPNVQNPVISVTTTMPGATPQS
    Newman          MIKKLLQFSLGNKFAIFLMVVLVVLGGVYASAKLKLELLPNVQNPVISVTTTMPGATPQS
    USA300_FPR3757  MIKKLLQFSLGNKFAIFLMVVLVVLGGVYASAKLKLELLPNVQNPVISVTTTMPGATPQS
                    ************************************************************

    COL             TQDEISSKIDNQVRSLAYVKNVKTQSIQNASIVTVEYENNTDMDKAEEQLKKEIDKIKFK
    N315            TQDEISSKIDNQVRSLAYVKNVKTQSIQNASIVTVEYENNTDMDKAEEQLKKEIDKIKFK
    NCTC8325        TQDEISSKIDNQVRSLAYVKNVKTQSIQNASIVTVEYENNTDMDKAEEQLKKEIDKIKFK
    Newman          TQDEISSKIDNQVRSLAYVKNVKTQSIQNASIVTVEYENNTDMDKAEEQLKKEIDKIKFK
    USA300_FPR3757  TQDEISSKIDNQVRSLAYVKNVKTQSIQNASIVTVEYENNTDMDKAEEQLKKEIDKIKFK
                    ************************************************************

    COL             DEVGQPELRRNSMDAFPVLAYSFSNKENDLKKVTKVLNEQLIPKLQTVDGVQNAQLNGQT
    N315            DEVGQPELRRNSMDAFPVLAYSFSNKENDLKKVTKVLNEQLIPKLQTVDGVQNAQLNGQT
    NCTC8325        DEVGQPELRRNSMDAFPVLAYSFSNKENDLKKVTKVLNEQLIPKLQTVDGVQNAQLNGQT
    Newman          DEVGQPELRRNSMDAFPVLAYSFSNKENDLKKVTKVLNEQLIPKLQTVDGVQNAQLNGQT
    USA300_FPR3757  DEVGQPELRRNSMDAFPVLAYSFSNKENDLKKVTKVLNEQLIPKLQTVDGVQNAQLNGQT
                    ************************************************************

    COL             NREITLKFKQNELEKYGLTADDVENYLKTATRTTPLGLFQFGDKDKSIVVDGQYQSVDAF
    N315            NREITLKFKQNELEKYGLTADDVENYLKTATRTTPLGLFQFGDKDKSIVVDGQYQSVDAF
    NCTC8325        NREITLKFKQNELEKYGLTADDVENYLKTATRTTPLGLFQFGDKDKSIVVDGQYQSVDAF
    Newman          NREITLKFKQNELEKYGLTADDIENYLKTATRTTPLGLFQFGDKDKSIVVDGQYQSVDAF
    USA300_FPR3757  NREITLKFKQNELEKYGLTADDVENYLKTATRTTPLGLFQFGDKDKSIVVDGQYQSVDAF
                    **********************:*************************************

    COL             KNINIPLTLAGGQGQSQSQSDNKQNSAMSDVNQASPQQNSKASAPNNISGMPTAKLGDLA
    N315            KNINIPLTLAGGQGQSQSQSDNKQNSAMSDVNQASPQQNSKASAPNNISGMPTAKLGDLA
    NCTC8325        KNINIPLTLAGGQGQSQSQSDNKQNSAMSDVNQASPQQNSKASAPNNISGMPTAKLGDLA
    Newman          KNINIPLTLAGGQGQSQSQSDNKQNSAMSDVNQASPQQNSKASAPNNISGMPTAKLGDLA
    USA300_FPR3757  KNINIPLTLAGGQGQSQSQSDNKQNSAMSDVNQASPQQNSKASAPNNISGMPTAKLGDLA
                    ************************************************************

    COL             DITVGDVRTSISKTNGKDAVNLQITKAQDANTVQVAKDVQRKIDTFVDENKDFNVTKTMD
    N315            DITVGDVRTSISKTNGKDAVNLQITKAQDANTVQVAKDVQRKIDTFVDENKDFNVTKTMD
    NCTC8325        DITVGDVRTSISKTNGKDAVNLQITKAQDANTVQVAKDVQRKIDTFVDENKDFNVTKTMD
    Newman          DITVGDVRTSISKTNGKDAVNLQITKAQDANTVQVAKDVQRKIDTFVDENKDFNVTKTMD
    USA300_FPR3757  DITVGDVRTSISKTNGKDAVNLQITKAQDANTVQVAKDVQRKIDTFVDENKDFNVTKTMD
                    ************************************************************

    COL             TAKPVEKSLYTMVEKASLGTIVAIIVILLFLRNIRTTAISIISIPLSLLMALIALKLSDV
    N315            TAKPVEKSLYTMVEKASLGTIVAIIVILLFLRNIRTTAISIISIPLSLLMALIALKLSDV
    NCTC8325        TAKPVEKSLYTMVEKASLGTIVAIIVILLFLRNIRTTAISIISIPLSLLMALIALKLSDV
    Newman          TAKPVEKSLYTMVEKASLGTIVAIIVILLFLRNIRTTAISIISIPLSLLMALIALKLSDV
    USA300_FPR3757  TAKPVEKSLYTMVEKASLGTIVAIIVILLFLRNIRTTAISIISIPLSLLMALIALKLSDV
                    ************************************************************

    COL             SLNILTLGALTVAIGRVIDDSIVVVENIYRRLTDSEEQLKGENLIISATTEVFKPIMSST
    N315            SLNILTLGALTVAIGRVIDDSIVVVENIYRRLTDSEEQLKGENLIISATTEVFKPIMSST
    NCTC8325        SLNILTLGALTVAIGRVIDDSIVVVENIYRRLTDSEEQLKGENLIISATTEVFKPIMSST
    Newman          SLNILTLGALTVAIGRVIDDSIVVVENIYRRLTDSEEQLKGENLIISATTEVFKPIMSST
    USA300_FPR3757  SLNILTLGALTVAIGRVIDDSIVVVENIYRRLTDSEEQLKGENLIISATTEVFKPIMSST
                    ************************************************************

    COL             LVTIIVFLPLVFVSGSVGEMFRPFALAIAFSLLASLLVSITLVPALAATLFKKGVKRRNK
    N315            LVTIIVFLPLVFVSGSVGEMFRPFALAIAFSLLASLLVSITLVPALAATLFKKGVKRRNK
    NCTC8325        LVTIIVFLPLVFVSGSVGEMFRPFALAIAFSLLASLLVSITLVPALAATLFKKGVKRRNK
    Newman          LVTIIVFLPLVFVSGSVGEMFRPFALAIAFSLLASLLVSITLVPALAATLFKKGVKRRNK
    USA300_FPR3757  LVTIIVFLPLVFVSGSVGEMFRPFALAIAFSLLASLLVSITLVPALAATLFKKGVKRRNK
                    ************************************************************

    COL             QHQEGLGVVSTTYKKVLHWSLNHKWIVIILSTLILVATIVFGGPRLGTSFISAGDDKFLA
    N315            QHQEGLGVVSTTYKKVLHWSLNHKWIVIILSTLILVATIVFGGPRLGTSFISAGDDKFLA
    NCTC8325        QHQEGLGVVSTTYKKVLHWSLNHKWIVIILSTLILVATIVFGGPRLGTSFISAGDDKFLA
    Newman          QHQEGLGVVSTTYKKVLHWSLNHKWIVIILSTLILVATIVFGGPRLGTSFISAGDDKFLA
    USA300_FPR3757  QHQEGLGVVSTTYKKVLHWSLNHKWIVIILSTLILVATIVFGGPRLGTSFISAGDDKFLA
                    ************************************************************

    COL             ITYTPKPGETEQAVLNHAKDVEKYLKQKKHVKTIQYSVGGSSPVDPTGSTNSMAIMVEYD
    N315            ITYTPKPGETEQAVLNHAKDVEKYLKQKKHVKTIQYSVGGSSPVDPTGSTNSMAIMVEYD
    NCTC8325        ITYTPKPGETEQAVLNHAKDVEKYLKQKKHVKTIQYSVGGSSPVDPTGSTNSMAIMVEYD
    Newman          ITYTPKPGETEQAVLNHAKDVEKYLKQKKHVKTIQYSVGGSSPVDPTGSTNSMAIMVEYD
    USA300_FPR3757  ITYTPKPGETEQAVLNHAKDVEKYLKQKKHVKTIQYSVGGSSPVDPTGSTNSMAIMVEYD
                    ************************************************************

    COL             NDTPNFDVEADKVIKHADGFKHPGEWKNQDLGTGAGNKSVEVTVKGPSMDAIKSTVKDIE
    N315            NDTPNFDVEADKVIKHVDGFKHPGEWKNQDLGTGAGNKSVEVTVKGPSMDAIKSTVKDIE
    NCTC8325        NDTPNFDVEADKVIKHADGFKHPGEWKNQDLGTGAGNKSVEVTVKGPSMDAIKSTVKDIE
    Newman          NDTPNFDVEADKVIKHADGFKHPGEWKNQDLGTGAGNKSVEVTVKGPSMDAIKSTVKDIE
    USA300_FPR3757  NDTPNFDVEADKVIKHADGFKHPGEWKNQDLGTGAGNKSVEVTVKGPSMDAIKSTVKDIE
                    ****************.*******************************************

    COL             QKMKQVKGLANVKSDLSQTYDQYEIKVDQNKAAENGISASQLAMHLNENLPEKTVTTVKE
    N315            QKMKQVKGLANVKSDLSQTYDQYEIKVDQNKAAENGISASQLAMHLNENLPEKTVTTVKE
    NCTC8325        QKMKQVKGLANVKSDLSQTYDQYEIKVDQNKAAENGISASQLAMHLNENLPEKTVTTVKE
    Newman          QKMKQVKGLANVKSDLSQTYDQYEIKVDQNKAAENGISASQLAMHLNENLPEKTVTTVKE
    USA300_FPR3757  QKMKQVKGLANVKSDLSQTYDQYEIKVDQNKAAENGISASQLAMHLNENLPEKTVTTVKE
                    ************************************************************

    COL             NGKTVDVKVKQNKQTDWSEDKLNNITLKKPTGGTIKLGDIATLVKTTTPSKLTQEQGDYA
    N315            NGKTVDVKVKQNKQTDWSEDKLNNITLKKPTGGTIKLGDIATLVKTTTPSKLTQEQGDYA
    NCTC8325        NGKTVDVKVKQNKQTDWSEDKLNNITLKKPTGGTIKLGDIATLVKTTTPSKLTQEQGDYA
    Newman          NGKTVDVKVKQNKQTDWSEDKLNNITLKKPTGGTIKLGDIATLVKTTTPSKLTQEQGDYA
    USA300_FPR3757  NGKTVDVKVKQNKQTDWSEDKLNNITLKKPTGGTIKLGDIATLVKTTTPSKLTQEQGDYA
                    ************************************************************

    COL             TTVSAKVTNKDVGGTTRQVMSKINNLDKPNNVKVNIGGASDDINNAMTQLAFAMLAAIII
    N315            TTVSAKVTNKDVGGTTRQVMSKINNLDKPNNVKVNIGGASDDINNAMTQLAFAMLAAIII
    NCTC8325        TTVSAKVTNKDVGGTTRQVMSKINNLDKPNNVKVNIGGASDDINNAMTQLAFAMLAAIII
    Newman          TTVSAKVTNKDVGGTTRQVMSKINNLDKPNNVKVNIGGASDDINNAMTQLAFAMLAAIII
    USA300_FPR3757  TTVSAKVTNKDVGGTTRQVMSKINNLDKPNNVKVNIGGASDDINNAMTQLAFAMLAAIII
                    ************************************************************

    COL             VYLILVITFKGGLAPFTILFSLPFTVIGVIIALLITGETISVPSLIGMLMLIGIVVTNAI
    N315            VYLILVITFKGGLAPFTILFSLPFTVIGVIIALLITGETISVPSLIGMLMLIGIVVTNAI
    NCTC8325        VYLILVITFKGGLAPFTILFSLPFTVIGVIIALLITGETISVPSLIGMLMLIGIVVTNAI
    Newman          VYLILVITFKGGLAPFTILFSLPFTVIGVIIALLITGETISVPSLIGMLMLIGIVVTNAI
    USA300_FPR3757  VYLILVITFKGGLAPFTILFSLPFTVIGVIIALLITGETISVPSLIGMLMLIGIVVTNAI
                    ************************************************************

    COL             VLIDRVINNEQQGMEMKEALIEAGGTRIRPILMTAIATIGALVPLLFGQDSSILISKGLA
    N315            VLIDRVINNEQQGMEMKEALIEAGGTRIRPILMTAIATIGALVPLLFGQDSSILISKGLA
    NCTC8325        VLIDRVINNEQQGMEMKEALIEAGGTRIRPILMTAIATIGALVPLLFGQDSSILISKGLA
    Newman          VLIDRVINNEQQGMEMKEALIEAGGTRIRPILMTAIATIGALVPLLFGQDSSILISKGLA
    USA300_FPR3757  VLIDRVINNEQQGMEMKEALIEAGGTRIRPILMTAIATIGALVPLLFGQDSSILISKGLA
                    ************************************************************

    COL             ATVIGGLISSTLLTLVVVPVIYEILFTLKKRFTKR
    N315            ATVIGGLISSTLLTLVVVPVIYEILFTLKKRFTKR
    NCTC8325        ATVIGGLISSTLLTLVVVPVIYEILFTLKKRFTKR
    Newman          ATVIGGLISSTLLTLVVVPVIYEILFTLKKRFTKR
    USA300_FPR3757  ATVIGGLISSTLLTLVVVPVIYEILFTLKKRFTKR
                    ***********************************