From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: saupan005719000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 5826299..5826550
  • synteny block?: BlockID0044650
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2201
    08BA02176:
    C248_2300
    11819-97:
    71193:
    ST398NM01_2982
    ECT-R 2:
    ED133:
    SAOV_2301
    ED98:
    HO 5096 0412:
    SAEMRSA15_21610
    JH1:
    SaurJH1_2330
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2347
    MSHR1132:
    SAMSHR1132_20880
    MSSA476:
    SAS2153
    Mu3:
    SAHV_2247
    Mu50:
    SAV2263
    MW2:
    MW2181
    RF122:
    SAB2135
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MRTIILSLFIIMNIVAIIMTLSQPLTVNYFSLRVILIFFTFILSIFFILIKSSRLNNILT
    NCTC8325        MRTIILSLFIIMNIVAIIMTLSQPLTVNYFSLRVILIFFTFILSIFFILIKSSRLNNILT
                    ************************************************************

    N315            ILSIVLVIIHMGILAHSTYVYLY
    NCTC8325        ILSIVLVIIHMGILAHSTYVYLY
                    ***********************