From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005735000
  • symbol?: moaC
  • description?: molybdenum cofactor biosynthesis protein MoaC

      descriptions from strain specific annotations:

    • molybdenum cofactor biosynthesis protein MoaC
    • cyclic pyranopterin monophosphate synthase MoaC
    • molybdenum cofactor biosynthesis protein C
    • putative molybdenum cofactor biosynthesis protein C
  • strand?: +
  • coordinates?: 5834991..5835485
  • synteny block?: BlockID0044810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2267 (moaC)
    N315:
    SA2069 (moaC)
    NCTC8325:
    Newman:
    NWMN_2174 (moaC)
    USA300_FPR3757:
    04-02981:
    SA2981_2212 (moaC)
    08BA02176:
    C248_2312 (moaC)
    11819-97:
    MS7_2293 (moaC)
    71193:
    ST398NM01_2325
    ECT-R 2:
    ECTR2_2135 (moaC)
    ED133:
    SAOV_2313
    ED98:
    SAAV_2337 (moaC)
    HO 5096 0412:
    SAEMRSA15_21720 (moaC)
    JH1:
    SaurJH1_2341 (moaC)
    JH9:
    SaurJH9_2299 (moaC)
    JKD6008:
    SAA6008_02311 (moaC)
    JKD6159:
    SAA6159_02179 (moaC)
    LGA251:
    SARLGA251_20580 (moaC)
    M013:
    M013TW_2232
    MRSA252:
    SAR2358 (moaC)
    MSHR1132:
    SAMSHR1132_20990
    MSSA476:
    SAS2164 (moaC)
    Mu3:
    SAHV_2258 (moaC)
    Mu50:
    SAV2274 (moaC)
    MW2:
    MW2192 (moaC)
    RF122:
    SAB2146 (moaC)
    ST398:
    SAPIG2325 (moaC)
    T0131:
    SAT0131_02452
    TCH60:
    HMPREF0772_10924 (moaC)
    TW20:
    SATW20_24060 (moaC)
    USA300_TCH1516:
    USA300HOU_2256 (moaC)
    VC40:
    SAVC_10235 (moaC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEFTHINQQGHAKMVDVSDKQITKRTAVAHSSITVNETIFKQISNNTNTKGNVLNTAQI
    N315            MTEFTHINQQGHAKMVDVSDKQITKRTAVAHSSITVNETIFKQISNNTNTKGNVLNTAQI
    NCTC8325        MTEFTHINQQGHAKMVDVSDKQITKRTAVAHSSITVNETIFKQISNNTNTKGNVLNTAQI
    Newman          MTEFTHINQQGHAKMVDVSDKQITKRTAVAHSSITVNETIFKQISNNTNTKGNVLNTAQI
    USA300_FPR3757  MTEFTHINQQGHAKMVDVSDKQITKRTAVAHSSITVNETIFKQISNNTNTKGNVLNTAQI
                    ************************************************************

    COL             AGIMAAKNTSTLIPMCHPLPLTGIDVHFSWDETNAPLYTLNIQTTVSTTGKTGVEMEALT
    N315            AGIMAAKNTSTIIPMCHPLPLTGIDVHFSWDETNAPLYTLNIQTTVSTTGKTGVEMEALT
    NCTC8325        AGIMAAKNTSTLIPMCHPLPLTGIDVHFSWDETNAPLYTLNIQTTVSTTGKTGVEMEALT
    Newman          AGIMAAKNTSTLIPMCHPLPLTGIDVHFSWDETNAPLYTLNIQTTVSTTGKTGVEMEALT
    USA300_FPR3757  AGIMAAKNTSTLIPMCHPLPLTGIDVHFSWDETNAPLYTLNIQTTVSTTGKTGVEMEALT
                    ***********:************************************************

    COL             AASATALTIYDMTKAVDKGMIIGETYLESKSGGKSGDFQRQSNQ
    N315            AASATALTIYDMTKAVDKGMIIGETYLESKSGGKSGDFQRQSGQ
    NCTC8325        AASATALTIYDMTKAVDKGMIIGETYLESKSGGKSGDFQRQSNQ
    Newman          AASATALTIYDMTKAVDKGMIIGETYLESKSGGKSGDFQRQSNQ
    USA300_FPR3757  AASATALTIYDMTKAVDKGMIIGETYLESKSGGKSGDFQRQSNQ
                    ******************************************.*