From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005738000
  • symbol?: modC
  • description?: molybdenum transport ATP-binding protein ModC

      descriptions from strain specific annotations:

    • molybdenum transport ATP-binding protein ModC
    • ABC transporter
    • molybdenum ABC transporter, ATP-binding protein ModC
    • ABC transporter family protein
    • molybdenum ABC transporter ATP-binding protein ModC
    • putative molybdenum transport ATP-bindingprotein
    • molybdenum (Mo2+) ABC superfamily ATP binding cassette transporter, ABC protein
    • molybdate ABC superfamily ATP binding cassette transporter, ABC protein
    • molybdenum import ATP-binding protein ModC
  • strand?: -
  • coordinates?: 5837206..5837811
  • synteny block?: BlockID0044840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2270 (modC)
    N315:
    SA2072 (modC)
    NCTC8325:
    Newman:
    NWMN_2177 (modC)
    USA300_FPR3757:
    04-02981:
    SA2981_2215 (modC)
    08BA02176:
    C248_2315 (modC)
    11819-97:
    MS7_2296
    71193:
    ST398NM01_2328
    ECT-R 2:
    ECTR2_2138
    ED133:
    SAOV_2316c
    ED98:
    SAAV_2340 (modC)
    HO 5096 0412:
    SAEMRSA15_21750 (modC)
    JH1:
    SaurJH1_2344
    JH9:
    SaurJH9_2302
    JKD6008:
    SAA6008_02314 (modC)
    JKD6159:
    SAA6159_02182 (modC)
    LGA251:
    SARLGA251_20610 (modC)
    M013:
    M013TW_2235
    MRSA252:
    SAR2361 (modC)
    MSHR1132:
    SAMSHR1132_21020
    MSSA476:
    SAS2167
    Mu3:
    SAHV_2261 (modC)
    Mu50:
    SAV2277 (modC)
    MW2:
    MW2195 (modC)
    RF122:
    SAB2149c (modC)
    ST398:
    SAPIG2328
    T0131:
    SAT0131_02455 (isdB)
    TCH60:
    HMPREF0772_10921 (modC)
    TW20:
    SATW20_24090 (modC)
    USA300_TCH1516:
    USA300HOU_2259 (modC)
    VC40:
    SAVC_10250

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQ
    N315            MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQ
    NCTC8325        MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQ
    Newman          MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQ
    USA300_FPR3757  MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQ
                    ************************************************************

    COL             LLTDTAKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHIDQLIQTLNIDHLM
    N315            LLTDTTKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSKHIDQLIQTLNINHLM
    NCTC8325        LLTDTAKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHIDQLIQTLNIDHLM
    Newman          LLTDTAKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHIDQLIQTLNIDHLM
    USA300_FPR3757  LLTDTAKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHIDQLIQTLNIDHLM
                    *****:**************************************:***********:***

    COL             KQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPI
    N315            KQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPI
    NCTC8325        KQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPI
    Newman          KQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPI
    USA300_FPR3757  KQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPI
                    ************************************************************

    COL             IFVTHSNYEAEQMAHEIITIG
    N315            IFVTHSNYEAEQMAHEIITIG
    NCTC8325        IFVTHSNYEAEQMAHEIITIG
    Newman          IFVTHSNYEAEQMAHEIITIG
    USA300_FPR3757  IFVTHSNYEAEQMAHEIITIG
                    *********************