From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005743000
  • symbol?:
  • description?: N-acetyltransferase GCN5

      descriptions from strain specific annotations:

    • N-acetyltransferase GCN5
    • Acetyltransferase
    • acetyltransferase (GNAT) family protein
    • acetyltransferase, GNAT family protein
    • GNAT family acetyltransferase
  • strand?: -
  • coordinates?: 5841518..5842304
  • synteny block?: BlockID0044890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2219
    08BA02176:
    C248_2319
    11819-97:
    MS7_2300
    71193:
    ST398NM01_2332
    ECT-R 2:
    ECTR2_2142
    ED133:
    SAOV_2320c
    ED98:
    SAAV_2344
    HO 5096 0412:
    SAEMRSA15_21790
    JH1:
    SaurJH1_2348
    JH9:
    SaurJH9_2306
    JKD6008:
    SAA6008_02318
    JKD6159:
    SAA6159_02186
    LGA251:
    SARLGA251_20650
    M013:
    M013TW_2239
    MRSA252:
    SAR2365
    MSHR1132:
    SAMSHR1132_21070
    MSSA476:
    SAS2171
    Mu3:
    SAHV_2265
    Mu50:
    SAV2281
    MW2:
    MW2199
    RF122:
    SAB2153c
    ST398:
    SAPIG2332
    T0131:
    SAT0131_02459 (isdD)
    TCH60:
    HMPREF0772_10917
    TW20:
    SATW20_24130
    USA300_TCH1516:
    USA300HOU_2263
    VC40:
    SAVC_10270

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MASISMSDIYCNGTIFENDDEQLIYLTPSFPQRYTSNTWIYKKTPTQERWLKDLERQH
    N315            --MASISMSDIYCNGTIFENDDEQLIYLTPSFPQRYTSNTWIYKKTPTQERWLKDLERQH
    NCTC8325        --MASISMSDIYCNGTIFENDDEQLIYLTPSFPQRYTSNTWIYKKTPTQERWLKDLERQH
    Newman          MSMASISMSDIYCNGTIFENDDEQLIYLTPSFPQRYTSNTWIYKKTPTQERWLKDLERQH
    USA300_FPR3757  --MASISMSDIYCNGTIFENDDEQLIYLTPSFPQRYTSNTWIYKKTPTQERWLKDLERQH
                      **********************************************************

    COL             QLHTNQGSNHYAFSFPENEQLDNHWMAMFKDMNFELGIMELYAIESDALANLPRNSDVEI
    N315            QLHTNQGSNHYAFSFPENEQLDNHWMAMFKDMNFELGIMELYAIESDALANLPRNSDVEI
    NCTC8325        QLHTNQGSNHYAFSFPENEQLDNHWMAMFKDMNFELGIMELYAIESDALANLPRNSDVEI
    Newman          QLHTNQGSNHYAFSFPENEQLDNHWMAMFKDMNFELGIMELYAIESDALANLPRNSDVEI
    USA300_FPR3757  QLHTNQGSNHYAFSFPENEQLDNHWMAMFKDMNFELGIMELYAIESDALANLPRNSDVEI
                    ************************************************************

    COL             AIVDESHIDAYLKVAYQFSLPFGKDYADAHEEMVREHYQKDVIKRLVAYLNNEPIGVVDV
    N315            AVVDESHIDAYLKVAYQFSLPFGKDYADAHEEMVREHYQKDVIKRLVAYLNNEPIGVVDV
    NCTC8325        AIVDESHIDAYLKVAYQFSLPFGKDYADAHEEMVREHYQKDVIKRLVAYLNNEPIGVVDV
    Newman          AIVDESHIDAYLKVAYQFSLPFGKDYADAHEEMVREHYQKDVIKRLVAYLNNEPIGVVDV
    USA300_FPR3757  AIVDESHIDAYLKVAYQFSLPFGKDYADAHEEMVREHYQKDVIKRLVAYLNNEPIGVVDV
                    *:**********************************************************

    COL             IESENYIELDGFGVLEQFRHQGIGSTIQSLIGEYAISKNHKPIILVADGEDTAKDMYAKQ
    N315            IESENYIELDGFGVLEQFRHQGIGSTIQSLIGEYAISKNHKPIILVTDGEDTAKDMYAKQ
    NCTC8325        IESENYIELDGFGVLEQFRHQGIGSTIQSLIGEYAISKNHKPIILVADGEDTAKDMYAKQ
    Newman          IESENYIELDGFGVLEQFRHQGIGSTIQSLIGEYAISKNHKPIILVADGEDTAKDMYAKQ
    USA300_FPR3757  IESENYIELDGFGVLEQFRHQGIGSTIQSLIGEYAISKNHKPIILVADGEDTAKDMYAKQ
                    **********************************************:*************

    COL             GYVYQSFCYQILKEDIGN
    N315            GYVYQSFCYQILKEDIGN
    NCTC8325        GYVYQSFCYQILKEDIGN
    Newman          GYVYQSFCYQILKEDIGN
    USA300_FPR3757  GYVYQSFCYQILKEDIGN
                    ******************