From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005756000
  • symbol?: ureE
  • description?: urease accessory protein UreE

      descriptions from strain specific annotations:

    • urease accessory protein UreE
    • ureE urease accessory , N-terminal domain protein
  • strand?: +
  • coordinates?: 5851005..5851457
  • synteny block?: BlockID0045020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2283 (ureE)
    N315:
    SA2085 (ureE)
    NCTC8325:
    Newman:
    NWMN_2191 (ureE)
    USA300_FPR3757:
    04-02981:
    SA2981_2229 (ureE)
    08BA02176:
    C248_2330 (ureE)
    11819-97:
    MS7_2309
    71193:
    ST398NM01_2341
    ECT-R 2:
    ECTR2_2151
    ED133:
    SAOV_2330
    ED98:
    SAAV_2353 (ureE)
    HO 5096 0412:
    SAEMRSA15_21880 (ureE)
    JH1:
    SaurJH1_2358 (ureE)
    JH9:
    SaurJH9_2315 (ureE)
    JKD6008:
    SAA6008_02327 (ureE)
    JKD6159:
    SAA6159_02195 (ureE)
    LGA251:
    SARLGA251_20740 (ureE)
    M013:
    M013TW_2248
    MRSA252:
    SAR2375 (ureE)
    MSHR1132:
    SAMSHR1132_21160
    MSSA476:
    SAS2181 (ureE)
    Mu3:
    SAHV_2275 (ureE)
    Mu50:
    SAV2291 (ureE)
    MW2:
    MW2209 (ureE)
    RF122:
    SAB2163 (ureE)
    ST398:
    SAPIG2341
    T0131:
    SAT0131_02469 (panB)
    TCH60:
    HMPREF0772_10907 (ureE)
    TW20:
    SATW20_24220 (ureE)
    USA300_TCH1516:
    USA300HOU_2272 (ureE)
    VC40:
    SAVC_10315 (ureE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIVEEIQGNIANLSNSEKQKHVEKVYLENSDLVKRIQRVVTDHGTEIGIRLKQPIDLQYG
    N315            MIVEEIQGNIANLSNSEKQKHVEKVYLENSDLVKRIQRVVTDHGTEIGIRLKQPIDLQYG
    NCTC8325        MIVEEIQGNIANLSNSEKQKHVEKVYLENSDLVKRIQRVVTDHGTEIGIRLKQPIDLQYG
    Newman          MIVEEIQGNIANLSNSEKQKHVEKVYLENSDLVKRIQRVVTDHGTEIGIRLKQPIDLQYG
    USA300_FPR3757  MIVEEIQGNIANLSNSEKQKHVEKVYLENSDLVKRIQRVVTDHGTEIGIRLKQPIDLQYG
                    ************************************************************

    COL             DILYADDHNMIIVDVNSEDLLVIQPRTLQEMGDIAHQLGNRHLPAQFTETEMLVQYDYLV
    N315            DILYADDHNMIIVDVNSEDLLVIQPRTLQEMGDIAHQLGNRHLPAQFTETEMLVQYDYLV
    NCTC8325        DILYADDHNMIIVDVNSEDLLVIQPRTLQEMGDIAHQLGNRHLPAQFTETEMLVQYDYLV
    Newman          DILYADDHNMIIVDVNSEDLLVIQPRTLQEMGDIAHQLGNRHLPAQFTETEMLVQYDYLV
    USA300_FPR3757  DILYADDHNMIIVDVNSEDLLVIQPRTLQEMGDIAHQLGNRHLPAQFTETEMLVQYDYLV
                    ************************************************************

    COL             EDLLKSLGIPYVREDRKVNKAFRHIGHSHD
    N315            EDLLKSLGIPYVREDRKVNKAFRHIGHSHD
    NCTC8325        EDLLKSLGIPYVREDRKVNKAFRHIGHSHD
    Newman          EDLLKSLGIPYVREDRKVNKAFRHIGHSHD
    USA300_FPR3757  EDLLKSLGIPYVREDRKVNKAFRHIGHSHD
                    ******************************