From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005759000
  • symbol?: ureD
  • description?: urease accessory protein UreD

      descriptions from strain specific annotations:

    • urease accessory protein UreD
    • ureD urease accessory family protein
  • strand?: +
  • coordinates?: 5852766..5853602
  • synteny block?: BlockID0045050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2286 (ureD)
    N315:
    SA2088 (ureD)
    NCTC8325:
    Newman:
    NWMN_2194 (ureD)
    USA300_FPR3757:
    04-02981:
    SA2981_2232 (ureD)
    08BA02176:
    C248_2333 (ureD)
    11819-97:
    MS7_2312
    71193:
    ST398NM01_2344
    ECT-R 2:
    ECTR2_2154
    ED133:
    SAOV_2333
    ED98:
    SAAV_2356 (ureD)
    HO 5096 0412:
    SAEMRSA15_21910 (ureD)
    JH1:
    SaurJH1_2361
    JH9:
    SaurJH9_2318
    JKD6008:
    SAA6008_02330
    JKD6159:
    SAA6159_02198 (ureD)
    LGA251:
    SARLGA251_20770 (ureD)
    M013:
    M013TW_2251
    MRSA252:
    SAR2378 (ureD)
    MSHR1132:
    SAMSHR1132_21190
    MSSA476:
    SAS2184
    Mu3:
    SAHV_2278 (ureD)
    Mu50:
    SAV2294 (ureD)
    MW2:
    MW2212 (ureD)
    RF122:
    SAB2166 (ureD)
    ST398:
    SAPIG2344 (ureD)
    T0131:
    SAT0131_02472 (ldh)
    TCH60:
    HMPREF0772_10904 (ureD)
    TW20:
    SATW20_24250 (ureD)
    USA300_TCH1516:
    USA300HOU_2275 (ureD)
    VC40:
    SAVC_10330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDEQQWTGQLDLTVFFDGNRSVSRDIFFEKALKVIRPVYLNQSTIPTFYIVNVGGGYLDG
    N315            ------------------------------------------------------------
    NCTC8325        MDEQQWTGQLDLTVFFDGNRSVSRDIFFEKALKVIRPVYLNQSTIPTFYIVNVGGGYLDG
    Newman          MDEQQWTGQLDLTVFFDGNRSVSRDIFFEKALKVIRPVYLNQSTIPTFYIVNVGGGYLDG
    USA300_FPR3757  MDEQQWTGQLDLTVFFDGNRSVSRDIFFEKALKVIRPVYLNQSTIPTFYIVNVGGGYLDG
                                                                                

    COL             DRYRMNVNVEDNAKVTLTSQGATKIYKTPSNHVEQYQTFNLKDNAYLEYVADPIIAYENA
    N315            ----MNVNVEDNAKVTLTSQGATKIYKTPSNHVEQYQTFNLKDNAYLEYVADPIIAYENA
    NCTC8325        DRYRMNVNVEDNAKVTLTSQGATKIYKTPSNHVEQYQTFNLKDNAYLEYVADPIIAYENA
    Newman          DRYRMNVNVEDNAKVTLTSQGATKIYKTPSNHVEQYQTFNLKDNAYLEYVADPIIAYENA
    USA300_FPR3757  DRYRMNVNVEDNAKVTLTSQGATKIYKTPSNHVEQYQTFNLKDNAYLEYVADPIIAYENA
                        ********************************************************

    COL             KFYQHNTFNLNNSSSLFYTDILTPGYSKTGEAFKYQYMHLINEIYIEDELVTYDNLLLNP
    N315            KFYQHNTFNLNNSSSLFYTDILTPGYSKTGEAFKYQYMHLINEIYIEDELVTYDNLLLNP
    NCTC8325        KFYQHNTFNLNNSSSLFYTDILTPGYSKTGEAFKYQYMHLINEIYIEDELVTYDNLLLNP
    Newman          KFYQHNTFNLNNSSSLFYTDILTPGYSKTGEAFKYQYMHLINEIYIEDELVTYDNLLLNP
    USA300_FPR3757  KFYQHNTFNLNNSSSLFYTDILTPGYSKTGEAFKYQYMHLINEIYIEDELVTYDNLLLNP
                    ************************************************************

    COL             NKQSINEIGYMEHYSHYGSAYFIHEDVNQKLIDSVYETISSYSNTFDCRVAISQLPTHGF
    N315            NKQSINEIGYMEHYSHYGSAYFIHEDVNQKLIDSVYETISSYSNTFDCRVAISQLPTHGF
    NCTC8325        NKQSINEIGYMEHYSHYGSAYFIHEDVNQKLIDSVYETISSYSNTFDCRVAISQLPTHGF
    Newman          NKQSINEIGYMEHYSHYGSAYFIHEDVNQKLIDSVYETISSYSNTFDCRVAISQLPTHGF
    USA300_FPR3757  NKQSINEIGYMEHYSHYGSAYFIHEDVNQKLIDSVYETISSYSNTFDCRVAISQLPTHGF
                    ************************************************************

    COL             AVRIFAYRTQIIEKILGTIQSYIAENIYDRKLDFLRKY
    N315            AVRIFAYRTQIIEKILGTIQSYIAENIYDRKLDFLRKY
    NCTC8325        AVRIFAYRTQIIEKILGTIQSYIAENIYDRKLDFLRKY
    Newman          AVRIFAYRTQIIEKILGTIQSYIAENIYDRKLDFLRKY
    USA300_FPR3757  AVRIFAYRTQIIEKILGTIQSYIAENIYDRKLDFLRKY
                    **************************************