From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005764000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • AraC family transcriptional regulator
    • Transcription regulator
    • regulatory helix-turn-helix proteins, AraC family protein
    • transcriptional regulator AraC family protein
    • AraC family regulatory protein
    • helix-turn-helix- domain containing protein
    • bacterial regulatory helix-turn-helix s, AraC family protein
    • transcriptional regulator, AraC family
    • putative transcriptional regulator
  • strand?: -
  • coordinates?: 5855731..5856810
  • synteny block?: BlockID0045100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2236
    08BA02176:
    C248_2337
    11819-97:
    MS7_2316
    71193:
    ST398NM01_2348
    ECT-R 2:
    ECTR2_2158
    ED133:
    SAOV_2337c
    ED98:
    SAAV_2360
    HO 5096 0412:
    SAEMRSA15_21950
    JH1:
    SaurJH1_2365
    JH9:
    SaurJH9_2322
    JKD6008:
    SAA6008_02334
    JKD6159:
    SAA6159_02202
    LGA251:
    SARLGA251_20810
    M013:
    M013TW_2255
    MRSA252:
    SAR2382
    MSHR1132:
    SAMSHR1132_21230
    MSSA476:
    SAS2188
    Mu3:
    SAHV_2282
    Mu50:
    SAV2298
    MW2:
    MW2216
    RF122:
    SAB2170c
    ST398:
    SAPIG2348
    T0131:
    SAT0131_02477 (rnhC)
    TCH60:
    HMPREF0772_10900
    TW20:
    SATW20_24290
    USA300_TCH1516:
    USA300HOU_2279
    VC40:
    SAVC_10350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTDNYSLHIYKSMKMSSVKEANLKIIYWLQGTGVVSINLQQYDVKRNDVTIIMLNDLYQI
    N315            MTDNYSLHIYKSMKMSSVKEANLKIIYWLQGTGVVSINLQQYDVKRNDVTVIMLNDLYQI
    NCTC8325        MTDNYSLHIYKSMKMSSVKEANLKIIYWLQGTGVVSINLQQYDVKRNDVTIIMLNDLYQI
    Newman          MTDNYSLHIYKSMKMSSVKEANLKIIYWLQGTGVVSINLQQYDVKRNDVTIIMLNDLYQI
    USA300_FPR3757  MTDNYSLHIYKSMKMSSVKEANLKIIYWLQGTGVVSINLQQYDLKRNYVTIIMLNDLYQI
                    *******************************************:*** **:*********

    COL             DGNDDSVCCVVEVSAKTFLKFMNANYMMRGKILTNEVASTFRILIKYLIYSKIKQQSYNA
    N315            DGHDDSVCCVVEVSAKTFLKFMNANYMMRGKILTNEVASTFRILIKYLIYSKIKQQSYNA
    NCTC8325        DGNDDSVCCVVEVSAKTFLKFMNANYMMRGKILTNEVASTFRILIKYLIYSKIKQQSYNA
    Newman          DGNDDSVCCVVEVSAKTFLKFMNANYMMRGKILTNEVASTFRILIKYLIYSKIKQQSYNA
    USA300_FPR3757  DGNDDSVCCVVEVSAKTFLKFMNANYMMRGKILTNEVASTFRILIKYLIYSKIKQQSYNA
                    **:*********************************************************

    COL             NDKIINYMCVELMSLNTYDGSRHLVAEEVHDYLTNNHHKKINRKDVINQVSITNKALSDM
    N315            NDKIINYMCVELMSLNTYDGSRHLVAEEVHDYLTNNHHKKINRKDVINQVSITNKALSDM
    NCTC8325        NDKIINYMCVELMSLNTYDGSRHLVAEEVHDYLTNNHHKKINRKDVINQVSITNKALSDM
    Newman          NDKIINYMCVELMSLNTYDGSRHLVAEEVHDYLTNNHHKKINRKDVINQVSITNKALSDM
    USA300_FPR3757  NDKIINYMCVELMSLNTYDGSRHLVAEEVHDYLTNNHHKKINRKDVINQVSITNKALSDM
                    ************************************************************

    COL             FKATPYSNFIQYLNHIRLEHCLIDILTSKKPIEEIASSHGFNHYSRFIHLFKETYGNTPK
    N315            FKATPYSNFIQYLNHIRLEHCLIDILTSKKPIEEIASSHGFNHYSRFIHLFKETYGNTPK
    NCTC8325        FKATPYSNFIQYLNHIRLEHCLIDILTSKKPIEEIASSHGFNHYSRFIHLFKETYGNTPK
    Newman          FKATPYSNFIQYLNHIRLEHCLIDILTSKKPIEEIASSHGFNHYSRFIHLFKETYGNTPK
    USA300_FPR3757  FKATPYSNFIQYLNHIRLEHCLIDILTSKKPIEEIASSHGFNHYSRFIHLFKETYGNTPK
                    ************************************************************

    COL             LIRKRYSPTSHSINHSQLVEIDKNIIELFDDTNQSSSSMREIDIPFEPTKRSQMYQPKNI
    N315            LIRKRYSPTSHSINHSQLVEIDKNIIELFDNTNQSSSSMREIDIPFEPTKRSQMYQPKNI
    NCTC8325        LIRKRYSPTSHSINHSQLVEIDKNIIELFDDTNQSSSSMREIDIPFEPTKRSQMYQPKNI
    Newman          LIRKRYSPTSHSINHSQLVEIDKNIIELFDDTNQSSSSMREIDIPFEPTKRSQMYQPKNI
    USA300_FPR3757  LIRKRYSPTSHSINHSQLVEIDKNIIELFDDTNQSSSSMREIDIPFEPTKRSQMYQPKNI
                    ******************************:*****************************

    COL             YIKGSNFYWMDYYTIKQIIQRLGVNPENLHIIVTIDTSNELSIEQITLLLQKIVNYNVNV
    N315            YIKGSNFYWMDYYTIKQIIQRLGVNLENLHIIVTIDTSNELSIEQITLLLQKIVNYNVNV
    NCTC8325        YIKGSNFYWMDYYTIKQIIQRLGVNPENLHIIVTIDTSNELSIEQITLLLQKIVNYNVNV
    Newman          YIKGSNFYWMDYYTIKQIIQRLGVNPENLHIIVTIDTSNELSIEQITLLLQKIVNYNVNV
    USA300_FPR3757  YIKGSNFYWMDYYTIKQIIQRLGVNPENLHIIVTIDTSNELSIEQITLLLQKIVNYNVNV
                    ************************* **********************************

    COL             VFRIKHEYKELLTSAERGKIEKLVATIFNMTFESNRCKIAFLINDLNTTAIQKLKRLIDN
    N315            VFRIKHEYKELLTSTERGKIEKLVATIFNMTFESNRCKIAFLINDLNTTAIQKLKRLIDN
    NCTC8325        VFRIKHEYKELLTSAERGKIEKLVATIFNMTFESNRCKIAFLINDLNTTAIQKLKRLIDN
    Newman          VFRIKHEYKELLTSAERGKIEKLVATIFNMTFESNRCKIAFLINDLNTTAIQKLKRLIDN
    USA300_FPR3757  VFRIKHEYKELLTSAERGKIEKLVATIFNMTFESNRCKIAFLINDLNTTAIQKLKRLIDN
                    **************:*********************************************

    COL             YIGVFELIYHLEPKELNTRYDKEIDHLIDYFILPLRQIEQVSIARSKIICDVDLINENND
    N315            YIGVFELIYHLEPKELNTHYDKEIDHLIDYFILPLRQIEQVSIACSKIICDVDLINENND
    NCTC8325        YIGVFELIYHLEPKELNTRYDKEIDHLIDYFILPLRQIEQVSIARSKIICDVDLINENND
    Newman          YIGVFELIYHLEPKELNTRYDKEIDHLIDYFILPLRQIEQVSIARSKIICDVDLINENND
    USA300_FPR3757  YIGVFELIYHLEPKELNTRYDKEIDHLIDYFILPLRQIEQVSIARSKIICDVDLINENND
                    ******************:************************* ***************

    COL             LKEKITMSDINKVSELLTNYTKFRGLIMHMSIISESSKEINLTRLSIFIFIINILNQLRG
    N315            LKEKITMSDFNKVTELLTNYTKFRGLIMHMSIISEASKEINLTRLSIFIFIINILNQLRG
    NCTC8325        LKEKITMSDINKVSELLTNYTKFRGLIMHMSIISESSKEINLTRLSIFIFIINILNQLRG
    Newman          LKEKITMSDINKVSELLTNYTKFRGLIMHMSIISESSKEINLTRLSIFIFIINILNQLRG
    USA300_FPR3757  LKEKITMSDINKVSELLTNYTKFRGLIMHMSIISESSKEINLTRLSIFIFIINILNQLRG
                    *********:***:*********************:************************

    COL             IVIYQNDTMIVTKFKHEVQCVICLPAALLNENSDAIRLSCKGLQQFSHAKTKQIVLSIDK
    N315            IVIYQNDTMIVTKFKHEVQCVICLPAALLNENSDAIRLSCKGLQQFSHAKTKQIVLSIDK
    NCTC8325        IVIYQNDTMIVTKFKHEVQCVICLPAALLNENSDAIRLSCKGLQQFSHAKTKQIVLSIDK
    Newman          IVIYQNDTMIVTKFKHEVQCVICLPAALLNENSDAIRLSCKGLQQFSHAKTKQIVLSIDK
    USA300_FPR3757  IVIYQNDTMIVTKFKHEVQCVICLPAALLNENSDAIRLSCKGLQQFSHAKTKQIVLSIDK
                    ************************************************************

    COL             DNHTSENGVLVNDIMQQHSYWKANFIERNIYDHSLMVSSNSIVHLKYHLEI
    N315            DNHTSENGVLVNDIMQQHSYWKANFIERNIYDHSLMVSSNSIVHLKYHLEI
    NCTC8325        DNHTSENGVLVNDIMQQHSYWKANFIERNIYDHSLMVSSNSIVHLKYHLEI
    Newman          DNHTSENGVLVNDIMQQHSYWKANFIERNIYDHSLMVSSNSIVHLKYHLEI
    USA300_FPR3757  DNHTSENGVLVNDIMQQHSYWKANFIERNIYDHSLMVSSNSIVHLKYHLEI
                    ***************************************************