From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005768000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5859138..5859310
  • synteny block?: BlockID0045140
  • occurrence?: in 38% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2238
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2986
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_21970
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2384
    MSHR1132:
    MSSA476:
    SAS2190
    Mu3:
    SAHV_2284
    Mu50:
    SAV2300
    MW2:
    MW2218
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_10898
    TW20:
    USA300_TCH1516:
    USA300HOU_2281
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            --------------------------------------MLFILYYRVNRIGENRNFEIFT
    NCTC8325        MTKLIENLKASIFVSTLTKNLSMYSRFDMPKFGCVNGCMLFILYYRVNRIGENRNFEIFT
                                                          **********************

    N315            NSIFFIEIKKANKALETLLA
    NCTC8325        NSIFFIEIKKANKALETLLA
                    ********************