From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005770000
  • symbol?:
  • description?: D-octopine dehydrogenase

      descriptions from strain specific annotations:

    • D-octopine dehydrogenase
    • NAD/NADP octopine/nopaline dehydrogenase
    • NAD/NADP octopine/nopaline dehydrogenase family protein
    • NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain protein
    • NAD-dependent glycerol-3-phosphate dehydrogenase family protein
    • putative dehydrogenase
    • Opine dehydrogenase
  • strand?: -
  • coordinates?: 5861098..5862180
  • synteny block?: BlockID0045160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2240
    08BA02176:
    C248_2341
    11819-97:
    MS7_2319
    71193:
    ST398NM01_2352
    ECT-R 2:
    ECTR2_2161
    ED133:
    SAOV_2341c
    ED98:
    SAAV_2363
    HO 5096 0412:
    SAEMRSA15_21990
    JH1:
    SaurJH1_2368
    JH9:
    SaurJH9_2325
    JKD6008:
    SAA6008_02337
    JKD6159:
    SAA6159_02205
    LGA251:
    SARLGA251_20840
    M013:
    M013TW_2258
    MRSA252:
    SAR2386
    MSHR1132:
    SAMSHR1132_21260
    MSSA476:
    SAS2192
    Mu3:
    SAHV_2286
    Mu50:
    SAV2302
    MW2:
    MW2220
    RF122:
    SAB2174c
    ST398:
    SAPIG2352
    T0131:
    SAT0131_02480
    TCH60:
    HMPREF0772_10896
    TW20:
    SATW20_24320
    USA300_TCH1516:
    USA300HOU_2283
    VC40:
    SAVC_10365

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIAIVGSGNGAVTAAVDMVSKGHDVKLYCRNQSISKFQNAIEKGGFDFNNEGDERFVKF
    N315            MKIAIVGSGNGAVTAAVDMVSKGHDVKLYCRNQSISKFQNAIEKGGFDFNNEGDERFVKF
    NCTC8325        MKIAIVGSGNGAVTAAVDMVSKGHDVKLYCRNQSISKFQNAIEKGGFDFNNEGDERFVKF
    Newman          MKIAIVGSGNGAVTAAVDMVSKGHDVKLYCRNQSISKFQNAIEKGGFDFNNEGDERFVKF
    USA300_FPR3757  MKIAIVGSGNGAVTAAVDMVSKGHDVKLYCRNQSISKFQNAIEKGGFDFNNEGDERFVKF
                    ************************************************************

    COL             TDISDDMEYVLKDAEIVQVIIPSSYIEYYADVMAEHVTDNQLIFFNMAAAMGSIRFMNVL
    N315            TDISDDMEYVLKDAEIVQVIIPSSYIEYYADVMAEHVTDNQLIFFNMAAAMGSIRFMNVL
    NCTC8325        TDISDDMEYVLKDAEIVQVIIPSSYIEYYADVMAEHVTDNQLIFFNMAAAMGSIRFMNVL
    Newman          TDISDDMEYVLKDAEIVQVIIPSSYIEYYADVMAEHVTDNQLIFFNMAAAMGSIRFMNVL
    USA300_FPR3757  TDISDDMEYVLKDAEIVQVIIPSSYIEYYADVMAEHVTDNQLIFFNMAAAMGSIRFMNVL
                    ************************************************************

    COL             EDRHIETKPQLAEANTLTYGTRVDFENAAVDLSLNVRRIFFSTYDRSCLNDCYDKVSSIY
    N315            EDRHIETKPQLAEANTLTYGTRVDFENAAVDLSLNVRRIFFSTYDRSCLNDCYDKVSSIY
    NCTC8325        EDRHIETKPQLAEANTLTYGTRVDFENAAVDLSLNVRRIFFSTYDRSCLNDCYDKVSSIY
    Newman          EDRHIETKPQLAEANTLTYGTRVDFENAAVDLSLNVRRIFFSTYDRSCLNDCYDKVSSIY
    USA300_FPR3757  EDRHIETKPQLAEANTLTYGTRVDFENAAVDLSLNVRRIFFSTYDRSCLNDCYDKVSSIY
                    ************************************************************

    COL             DHLVKEESLIKTNLENGNPEVHPGPTLLNVGRIDYAGEFALYKEGITKHTVRLLHAIELE
    N315            DHLVKEESLIKTNLENGNPEVHPGPTLLNVGRIDYAGEFALYKEGITKHTVRLLHAIELE
    NCTC8325        DHLVKEESLIKTNLENGNPEVHPGPTLLNVGRIDYAGEFALYKEGITKHTVRLLHAIELE
    Newman          DHLVKEESLIKTNLENGNPEVHPGPTLLNVGRIDYAGEFALYKEGITKHTVRLLHAIELE
    USA300_FPR3757  DHLVKEESLIKTNLENGNPEVHPGPTLLNVGRIDYAGEFALYKEGITKHTVRLLHAIELE
                    ************************************************************

    COL             RLNLGRRLGFELSTAKESRIERGYLERDKEDEPLNRLFNTSPVFSQIPGPNHVESRYLTE
    N315            RLNLGRRLGFELSTAKESRIERGYLERDKEDEPLNRLFNTSPVFSQIPGPNHVESRYLTE
    NCTC8325        RLNLGRRLGFELSTAKESRIERGYLERDKEDEPLNRLFNTSPVFSQIPGPNHVESRYLTE
    Newman          RLNLGRRLGFELSTAKESRIERGYLERDKEDEPLNRLFNTSPVFSQIPGPNHVESRYLTE
    USA300_FPR3757  RLNLGRRLGFELSTAKESRIERGYLERDKEDEPLNRLFNTSPVFSQIPGPNHVESRYLTE
                    ************************************************************

    COL             DIAYGLVLWSSLGRVIDVPTPNIDAVIVIASTILERDFFEEGLTVEEIGLDKLDLEKYLK
    N315            DIAYGLVLWSSLGRVIDVPTPNIDAVIVIASTILERDFFEEGLTVEEIGLDKLDLEKYLK
    NCTC8325        DIAYGLVLWSSLGRVIDVPTPNIDAVIVIASTILERDFFEEGLTVEEIGLDKLDLEKYLK
    Newman          DIAYGLVLWSSLGRVIDVPTPNIDAVIVIASTILERDFFEEGLTVEEIGLDKLDLEKYLK
    USA300_FPR3757  DIAYGLVLWSSLGRVIDVPTPNIDAVIVIASTILERDFFEEGLTVEEIGLDKLDLEKYLK
                    ************************************************************