From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005772000
  • symbol?:
  • description?: CHAP domain-containing protein

      descriptions from strain specific annotations:

    • CHAP domain-containing protein
    • staphyloxanthin biosynthesis protein, putative
    • Secretory antigen SsaA
    • staphylococcal secretory antigen ssaA
    • exported secretory antigen precursor
    • Secretory antigen SsaA-like protein
    • secretory antigen precursor SsaA
    • CHAP protein
    • secretory antigen ssaA2
    • N-acetylmuramoyl-L-alanine amidase Sle1
  • strand?: +
  • coordinates?: 5863092..5863598
  • synteny block?: BlockID0045180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2242 (ssaA)
    08BA02176:
    C248_2343
    11819-97:
    MS7_2321
    71193:
    ST398NM01_2354
    ECT-R 2:
    ECTR2_2163
    ED133:
    SAOV_2343
    ED98:
    SAAV_2365
    HO 5096 0412:
    SAEMRSA15_22010
    JH1:
    SaurJH1_2370
    JH9:
    SaurJH9_2327
    JKD6008:
    SAA6008_02339 (ssaA)
    JKD6159:
    SAA6159_02207 (ssaA)
    LGA251:
    SARLGA251_20860
    M013:
    M013TW_2260
    MRSA252:
    SAR2388
    MSHR1132:
    SAMSHR1132_21280
    MSSA476:
    SAS2194
    Mu3:
    SAHV_2288
    Mu50:
    SAV2304
    MW2:
    MW2222 (ssaA)
    RF122:
    SAB2176
    ST398:
    SAPIG2354
    T0131:
    SAT0131_02482
    TCH60:
    HMPREF0772_10894
    TW20:
    SATW20_24340
    USA300_TCH1516:
    USA300HOU_2285 (ssaA)
    VC40:
    SAVC_10375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLVTATTLTAGIGTALVGQAYHADAAENYTNYNNYNYNTTQTTTTTTTTTTTSSISHS
    N315            MKKLVTATTLTAGIGTALVGQAHHADAAENYTNYNNYNYNTTQTTTTTTTTTTTSSISHS
    NCTC8325        MKKLVTATTLTAGIGTALVGQAHHADAAENYTNYNNYNYNTTQTTTTTTTTTTTSSISHS
    Newman          MKKLVTATTLTAGIGTALVGQAHHADAAENYTNYNNYNYNTTQTTTTTTTTTTTSSISHS
    USA300_FPR3757  MKKLVTATTLTAGIGTALVGQAHHADAAENYTNYNNYNYNTTQTTTTTTTTTTTSSISHS
                    **********************:*************************************

    COL             GNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFG
    N315            GNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFG
    NCTC8325        GNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFG
    Newman          GNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFG
    USA300_FPR3757  GNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFG
                    ************************************************************

    COL             HVAYVESVNSDGSVTISEMNYSGGPFSVSSRTISASEAGNYNYIHI
    N315            HVAYVESVNSDGSVTISEMNYSGGPFSVSSRTISASEAGNYNYIHI
    NCTC8325        HVAYVESVNSDGSVTISEMNYSGGPFSVSSRTISASEAGNYNYIHI
    Newman          HVAYVESVNSDGSVTISEMNYSGGPFSVSSRTISASEAGNYNYIHI
    USA300_FPR3757  HVAYVESVNSDGSVTISEMNYSGGPFSVSSRTISASEAGNYNYIHI
                    **********************************************