From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005785000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5870376..5870849
  • synteny block?: BlockID0045300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2247 (yrhD)
    08BA02176:
    C248_2350
    11819-97:
    MS7_2325
    71193:
    ST398NM01_2359
    ECT-R 2:
    ECTR2_2167
    ED133:
    SAOV_2348c
    ED98:
    SAAV_2370
    HO 5096 0412:
    SAEMRSA15_22060
    JH1:
    SaurJH1_2375
    JH9:
    SaurJH9_2332
    JKD6008:
    SAA6008_02343
    JKD6159:
    SAA6159_02212
    LGA251:
    SARLGA251_20910
    M013:
    M013TW_2265
    MRSA252:
    SAR2392
    MSHR1132:
    SAMSHR1132_21330
    MSSA476:
    SAS2200
    Mu3:
    SAHV_2292
    Mu50:
    SAV2308
    MW2:
    MW2228
    RF122:
    SAB2185c
    ST398:
    SAPIG2359
    T0131:
    SAT0131_02487 (uvrC)
    TCH60:
    HMPREF0772_10887
    TW20:
    SATW20_24390
    USA300_TCH1516:
    USA300HOU_2290
    VC40:
    SAVC_10400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAERISSKIRRLEKSEEQIKLESLNEVTEAIAANKDSILKAIKLIKTLDDAKLLDALNGA
    N315            MAERISSKIRRLEKSEEQIKLESLNEVTEAIAANKDSILKAIKLIKTLDDAKLLDALNGA
    NCTC8325        MAERISSKIRRLEKSEEQIKLESLNEVTEAIAANKDSILKAIKLIKTLDDAKLLDALNGA
    Newman          MAERISSKIRRLEKSEEQIKLESLNEVTEAIAANKDSILKAIKLIKTLDDAKLLDALNGA
    USA300_FPR3757  MAERISSKIRRLEKSEEQIKLESLNEVTEAIAANKDSILKAIKLIKTLDDAKLLDALNGA
                    ************************************************************

    COL             IRGRQVIINKFAVELNKDIYTGLLSNMASMVFLLGELNVSDLSDFLNKVNKGLHVANQAS
    N315            IRGRQVIINKFAVELNKDIYTGLLSNMASMVFLLGELNVSDLSDFLNKVNKGLHVANQAS
    NCTC8325        IRGRQVIINKFAVELNKDIYTGLLSNMASMVFLLGELNVSDLSDFLNKVNKGLHVANQAS
    Newman          IRGRQVIINKFAVELNKDIYTGLLSNMASMVFLLGELNVSDLSDFLNKVNKGLHVANQAS
    USA300_FPR3757  IRGRQVIINKFAVELNKDIYTGLLSNMASMVFLLGELNVSDLSDFLNKVNKGLHVANQAS
                    ************************************************************

    COL             PNAKTTIRSLLGVLKDDDMNRSLTYMLNMLKGMSREE
    N315            PNAKTTIRSLLGVLKDDDMNRSLTYMLNMLKGMSREE
    NCTC8325        PNAKTTIRSLLGVLKDDDMNRSLTYMLNMLKGMSREE
    Newman          PNAKTTIRSLLGVLKDDDMNRSLTYMLNMLKGMSREE
    USA300_FPR3757  PNAKTTIRSLLGVLKDDDMNRSLTYMLNMLKGMSREE
                    *************************************