From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005796000
  • symbol?:
  • description?: alanine glycine permease

      descriptions from strain specific annotations:

    • alanine glycine permease
    • amino acid permease
    • putative amino acid permease
    • Amino acid permease-associated region
    • amino acid permease family protein
    • APC family amino acid-polyamine-organocation transporter
    • APC family proline transporter ProY
    • Histidine transport protein (permease)
    • proline-specific permease ProY
    • transporter
    • transporter ybxG
  • strand?: -
  • coordinates?: 5883733..5885112
  • synteny block?: BlockID0045410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2255
    08BA02176:
    C248_2358
    11819-97:
    MS7_2333
    71193:
    ST398NM01_2367
    ECT-R 2:
    ECTR2_2175
    ED133:
    SAOV_2356c
    ED98:
    SAAV_2378
    HO 5096 0412:
    SAEMRSA15_22140
    JH1:
    SaurJH1_2383
    JH9:
    SaurJH9_2340
    JKD6008:
    SAA6008_02352
    JKD6159:
    SAA6159_02220
    LGA251:
    SARLGA251_20990
    M013:
    M013TW_2273
    MRSA252:
    SAR2400
    MSHR1132:
    SAMSHR1132_21410
    MSSA476:
    SAS2209
    Mu3:
    SAHV_2300
    Mu50:
    SAV2316
    MW2:
    MW2237
    RF122:
    SAB2193c
    ST398:
    SAPIG2367
    T0131:
    SAT0131_02498
    TCH60:
    HMPREF0772_10879 (proY)
    TW20:
    SATW20_24480
    USA300_TCH1516:
    USA300HOU_2299
    VC40:
    SAVC_10445

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENNELQRGLSARQIQMIALGGTIGVGLFMGATSTIKWTGPSVILAYLIAGIFLFLIMRA
    N315            MENNELQRGLSARQIQMIALGGTIGVGLFMGATSTIKWTGPSVILAYLIAGIFLFLIMRA
    NCTC8325        MENNELQRGLSARQIQMIALGGTIGVGLFMGATSTIKWTGPSVILAYLIAGIFLFLIMRA
    Newman          MENNELQRGLSARQIQMIALGGTIGVGLFMGATSTIKWTGPSVILAYLIAGIFLFLIMRA
    USA300_FPR3757  MENNELQRGLSARQIQMIALGGTIGVGLFMGATSTIKWTGPSVILAYLIAGIFLFLIMRA
                    ************************************************************

    COL             MGEMIYLNPTTGSFATFASDYIHPAAGYMTAWSNIFQWIVVGMSEVIAVGEYMKFWFPEL
    N315            MGEMIYLNPTTGSFATFASDYIHPAAGYMTAWSNIFQWIVVGMSEVIAVGEYMKFWFPEL
    NCTC8325        MGEMIYLNPTTGSFATFASDYIHPAAGYMTAWSNIFQWIVVGMSEVIAVGEYMKFWFPEL
    Newman          MGEMIYLNPTTGSFATFASDYIHPAAGYMTAWSNIFQWIVVGMSEVIAVGEYMKFWFPEL
    USA300_FPR3757  MGEMIYLNPTTGSFATFASDYIHPAAGYMTAWSNIFQWIVVGMSEVIAVGEYMKFWFPEL
                    ************************************************************

    COL             PTWIPGVIAILLLMAANLFSVKAFGEFEFWFALIKVVTIILMIIAGFGLIFFGFGNGGHA
    N315            PTWIPGVIAILLLMAANLFSVKAFGEFEFWFALIKVVTIILMIIAGFGLIFFGFGNGGHA
    NCTC8325        PTWIPGVIAILLLMAANLFSVKAFGEFEFWFALIKVVTIILMIIAGFGLIFFGFGNGGHA
    Newman          PTWIPGVIAILLLMAANLFSVKAFGEFEFWFALIKVVTIILMIIAGFGLIFFGFGNGGHA
    USA300_FPR3757  PTWIPGVIAILLLMAANLFSVKAFGEFEFWFALIKVVTIILMIIAGFGLIFFGFGNGGHA
                    ************************************************************

    COL             VGISNLWTNGGFMPNGIVGFFFALSIVIGSYQGVELIGITAGETKDPQKNIVKAVNGVIW
    N315            VGISNLWTNGGFMPNGIVGFFFALSIVIGSYQGVELIGITAGETKDPQKNIVKAVNGVIW
    NCTC8325        VGISNLWTNGGFMPNGIVGFFFALSIVIGSYQGVELIGITAGETKDPQKNIVKAVNGVIW
    Newman          VGISNLWTNGGFMPNGIVGFFFALSIVIGSYQGVELIGITAGETKDPQKNIVKAVNGVIW
    USA300_FPR3757  VGISNLWTNGGFMPNGIVGFFFALSIVIGSYQGVELIGITAGETKDPQKNIVKAVNGVIW
                    ************************************************************

    COL             RILIFYLGAIFVIVSVYPWNQLGDIGSPFVATFAKIGITFAAGLINFVVLTAAMSGCNSG
    N315            RILIFYLGAIFVIVSVYPWNQLGDIGSPFVATFAKIGITFAAGLINFVVLTAAMSGCNSG
    NCTC8325        RILIFYLGAIFVIVSVYPWNQLGDIGSPFVATFAKIGITFAAGLINFVVLTAAMSGCNSG
    Newman          RILIFYLGAIFVIVSVYPWNQLGDIGSPFVATFAKIGITFAAGLINFVVLTAAMSGCNSG
    USA300_FPR3757  RILIFYLGAIFVIVSVYPWNQLGDIGSPFVATFAKIGITFAAGLINFVVLTAAMSGCNSG
                    ************************************************************

    COL             IFSASRMIYTLAHKGEMPKIFTKIMRNGVPLYTVVAVSLGILIGALLNVILPLYIDGAKS
    N315            IFSASRMIYTLAHKGEMPKIFTKIMRNGVPLYTVVAVSLGILIGALLNVILPLYIDGAKS
    NCTC8325        IFSASRMIYTLAHKGEMPKIFTKIMRNGVPLYTVVAVSLGILIGALLNVILPLYIDGAKS
    Newman          IFSASRMIYTLAHKGEMPKIFTKIMRNGVPLYTVVAVSLGILIGALLNVILPLYIDGAKS
    USA300_FPR3757  IFSASRMIYTLAHKGEMPKIFTKIMRNGVPLYTVVAVSLGILIGALLNVILPLYIDGAKS
                    ************************************************************

    COL             IFVYVYSASILPGMIPWFMILFSHLRFRKLHPEELEGHPFKMPGGAVTNYLTILFLILVL
    N315            IFVYVYSASILPGMIPWFMILFSHLRFRKLHPEELEGHPFKMPGGAVTNYLTILFLILVL
    NCTC8325        IFVYVYSASILPGMIPWFMILFSHLRFRKLHPEELEGHPFKMPGGAVTNYLTILFLILVL
    Newman          IFVYVYSASILPGMIPWFMILFSHLRFRKLHPEELEGHPFKMPGGAVTNYLTILFLILVL
    USA300_FPR3757  IFVYVYSASILPGMIPWFMILFSHLRFRKLHPEELEGHPFKMPGGAVTNYLTILFLILVL
                    ************************************************************

    COL             VGMVFNVETRISVLIGVIFLTIVTIYYFIRYNKNNVKAK
    N315            VGMVFNVETRISVLIGVIFLTIVTIYYFIRYNKNNVKAK
    NCTC8325        VGMVFNVETRISVLIGVIFLTIVTIYYFIRYNKNNVKAK
    Newman          VGMVFNVETRISVLIGVIFLTIVTIYYFIRYNKNNVKAK
    USA300_FPR3757  VGMVFNVETRISVLIGVIFLTIVTIYYFIRYNKNNVKAK
                    ***************************************