From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005800000
  • symbol?:
  • description?: phosphoglycolate phosphatase

      descriptions from strain specific annotations:

    • phosphoglycolate phosphatase
    • HAD superfamily hydrolase
    • HAD family hydrolase
    • haloacid dehalogenase-like hydrolase
    • HAD hydrolase family protein
  • strand?: -
  • coordinates?: 5886292..5886927
  • synteny block?: BlockID0045450
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2259
    08BA02176:
    C248_2362
    11819-97:
    MS7_2337
    71193:
    ST398NM01_2371
    ECT-R 2:
    ECTR2_2179
    ED133:
    SAOV_2360c
    ED98:
    SAAV_2382
    HO 5096 0412:
    SAEMRSA15_22180
    JH1:
    SaurJH1_2387
    JH9:
    SaurJH9_2344
    JKD6008:
    SAA6008_02356
    JKD6159:
    SAA6159_02224
    LGA251:
    SARLGA251_21030
    M013:
    M013TW_2277
    MRSA252:
    SAR2404
    MSHR1132:
    SAMSHR1132_21450
    MSSA476:
    SAS2213
    Mu3:
    SAHV_2304
    Mu50:
    SAV2320
    MW2:
    MW2241
    RF122:
    SAB2197c
    ST398:
    SAPIG2371
    T0131:
    SAT0131_02502
    TCH60:
    HMPREF0772_10875
    TW20:
    SATW20_24520
    USA300_TCH1516:
    VC40:
    SAVC_10465

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYRAVIFDFDGTIIDTEQHLFNVINKHLEMHNADPISIDFYRSSIGGAATDLHDHLIKAI
    N315            MYRAVIFDFDGTIIDTEQHLFNVINKHLEMHNADPISIDFYRSSIGGAATDLHDHLIKAI
    NCTC8325        MYRAVIFDFDGTIIDTEQHLFNVINKHLEMHNADPISIDFYRSSIGGAATDLHDHLIKAI
    Newman          MYRAVIFDFDGTIIDTEQHLFNVINKHLEMHNADPISIDFYRSSIGGAATDLHDHLIKAI
    USA300_FPR3757  MYRAVIFDFDGTIIDTEQHLFNVINKHLEMHNADPISIDFYRSSIGGAATDLHDHLIKAI
                    ************************************************************

    COL             GSENKDKLYEEHHLTSTTLPMIDTIKSLMAFLKQRHIPMAIATSSVKAEIMPTFKALGLD
    N315            GSENKDKLYEEHHLTSTTLPMIDTIKSLMAFLKQRHIPMAIATSSVKAEIMPTFKALGLD
    NCTC8325        GSENKDKLYEEHHLTSTTLPMIDTIKSLMAFLKQRHIPMAIATSSVKAEIMPTFKALGLD
    Newman          GSENKDKLYEEHHLTSTTLPMIDTIKSLMAFLKQRHIPMAIATSSVKAEIMPTFKALGLD
    USA300_FPR3757  GSENKDKLYEEHHLTSTTLPMIDTIKSLMAFLKQRHIPMAIATSSVKAEIMPTFKALGLD
                    ************************************************************

    COL             DYIEVVVGREDVEQVKPDPELYLSAVQQLNYMPTQCLAIEDSVNGATAAIAAGLDVIVNT
    N315            DYIEVVVGREDVEQVKPDPELYLSAVQQLNYMPTQCLAIEDSVNGATAAIAAGLDVIVNT
    NCTC8325        DYIEVVVGREDVEQVKPDPELYLSAVQQLNYMPTQCLAIEDSVNGATAAIAAGLDVIVNT
    Newman          DYIEVVVGREDVEQVKPDPELYLSAVQQLNYMPTQCLAIEDSVNGATAAIAAGLDVIVNT
    USA300_FPR3757  DYIEVVVGREDVEQVKPDPELYLSAVQQLNYMPTQCLAIEDSVNGATAAIAAGLDVIVNT
                    ************************************************************

    COL             NKMTSAQDFSNVDYVAKDIDYDQIVARFFTK
    N315            NKMTSAQDFSNVDYVAKDIDYDQIVARFFTK
    NCTC8325        NKMTSAQDFSNVDYVAKDIDYDQIVARFFTK
    Newman          NKMTSAQDFSNVDYVAKDIDYDQIVARFFTK
    USA300_FPR3757  NKMTSAQDFSNVDYVAKDIDYDQIVARFFTK
                    *******************************