Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005801000
  • symbol?:
  • description?: sodium-dependent transporter

      descriptions from strain specific annotations:

    • sodium-dependent transporter
    • bile acid:sodium symporter
    • sodium/bile acid symporter family protein
    • sodium Bile acid symporter family protein
    • BASS family bile acid:sodium (Na+) symporter
    • sodium/bile acid symporter family transporter
    • sodium-dependent transporter yocS
    • pseudogene
  • strand?: -
  • coordinates?: 5887002..5887871
  • synteny block?: BlockID0045460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2260
    08BA02176:
    C248_2363 (yocS)
    11819-97:
    MS7_2338
    71193:
    ST398NM01_2372
    ECT-R 2:
    ECTR2_2180
    ED133:
    SAOV_2361c
    ED98:
    SAAV_2383
    HO 5096 0412:
    SAEMRSA15_22190
    JH1:
    SaurJH1_2388
    JH9:
    SaurJH9_2345
    JKD6008:
    SAA6008_02357
    JKD6159:
    SAA6159_02225
    LGA251:
    SARLGA251_21040
    M013:
    M013TW_2278
    MRSA252:
    SAR2405
    MSHR1132:
    SAMSHR1132_21460
    MSSA476:
    SAS2214
    Mu3:
    SAHV_2305
    Mu50:
    SAV2321
    MW2:
    MW2242
    RF122:
    SAB2198c
    ST398:
    SAPIG2372
    T0131:
    SAT0131_02503
    TCH60:
    HMPREF0772_10874
    TW20:
    SATW20_24530
    USA300_TCH1516:
    USA300HOU_2301
    VC40:
    SAVC_10470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFQKLSIFATKSFLVWMLVAAVIGFIFPQHVATLGKWVPYLLGIVMLGMGLTITPNDFKM
    N315            MFQKLSIFATKSFLVWMLVAAVIGFIFPQHVATLGKWVPYLLGIVMLGMGLTITPNDFKM
    NCTC8325        MFQKLSIFATKSFLVWMLVAAVIGFIFPQHVATLGKWVPYLLGIVMLGMGLTITPNDFKM
    Newman          MFQKLSIFATKSFLVWMLVAAVIGFIFPQHVATLGKWVPYLLGIVMLGMGLTITPNDFKM
    USA300_FPR3757  MFQKLSIFATKSFLVWMLVAAVIGFIFPQHVATLGKWVPYLLGIVMLGMGLTITPNDFKM
                    ************************************************************

    COL             VFKAPRAVIIGVCLQFSIMPTLAFIIAKSFHLPPDIAVGVILVGCCPGGTSSNVMSYLAK
    N315            VFKAPRAVIIGVCLQFSIMPTLAFIIAKSFHLPPDIAVGVILVGCCPGGTSSNVMSYLAK
    NCTC8325        VFKAPRAVIIGVCLQFSIMPTLAFIIAKSFHLPPDIAVGVILVGCCPGGTSSNVMSYLAK
    Newman          VFKAPRAVIIGVCLQFSIMPTLAFIIAKSFHLPPDIAVGVILVGCCPGGTSSNVMSYLAK
    USA300_FPR3757  VFKAPRAVIIGVCLQFSIMPTLAFIIAKSFHLPPDIAVGVILVGCCPGGTSSNVMSYLAK
                    ************************************************************

    COL             ANVALSVSITTVSTLLAPFVTPALIYLFANEWLEVSFVSMLWSVVQVVLIPIALGIVLQI
    N315            ANVALSVSITTVSTLLAPFVTPALIYLFANEWLEVSFLSMLWSVVQVVLIPIALGIVLQI
    NCTC8325        ANVALSVSITTVSTLLAPFVTPALIYLFANEWLEVSFVSMLWSVVQVVLIPIALGIVLQI
    Newman          ANVALSVSITTVSTLLAPFVTPALIYLFANEWLEVSFVSMLWSVVQVVLIPIALGIVLQI
    USA300_FPR3757  ANVALSVSITTVSTLLAPFVTPALIYLFANEWLEVSFVSMLWSVVQVVLIPIALGIVLQI
                    *************************************:**********************

    COL             INRKIAEKASTALPIISVVAISLILAIVVGGSKHQILTTGLLIFLVVILHNVLGYTIGYW
    N315            INRKIAEKASTALPIISVVAISLILAIVVGGSKHQILTTGLLIFLVVILHNVLGYTIGYW
    NCTC8325        INRKIAEKASTALPIISVVAISLILAIVVGGSKHQILTTGLLIFLVVILHNVLGYTIGYW
    Newman          INRKIAEKASTALPIISVVAISLILAIVVGGSKHQILTTGLLIFLVVILHNVLGYTIGYW
    USA300_FPR3757  INRKIAEKASTALPIISVVAISLILAIVVGGSKHQILTTGLLIFLVVILHNVLGYTIGYW
                    ************************************************************

    COL             LARLLKLDRQDQKAVSIEVGMQNSGLAVSLAALHFNPIAAVPGAVFSFIHNITGPILAKY
    N315            LARLLKLDRQDQKAVSIEVGMQNSGLAVSLAALHFNPIAAVPGAVFSFIHNITGPILAKY
    NCTC8325        LARLLKLDRQDQKAVSIEVGMQNSGLAVSLAALHFNPIAAVPGAVFSFIHNITGPILAKY
    Newman          LARLLKLDRQDQKAVSIEVGMQNSGLAVSLAALHFNPIAAVPGAVFSFIHNITGPILAKY
    USA300_FPR3757  LARLLKLDRQDQKAVSIEVGMQNSGLAVSLAALHFNPIAAVPGAVFSFIHNITGPILAKY
                    ************************************************************

    COL             WSKKL
    N315            WSKKL
    NCTC8325        WSKKL
    Newman          WSKKL
    USA300_FPR3757  WSKKL
                    *****