From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005803000
  • symbol?: glvC
  • description?: PTS alpha-glucoside transporter subunit IIBC

      descriptions from strain specific annotations:

    • PTS alpha-glucoside transporter subunit IIBC
    • PTS system, IIBC components
    • PTS system arbutin-like transporter subunit IIBC
    • PTS system transporter
    • PTS system, alpha-glucoside-specific IIBC component
    • PTS system, arbutin-like IIBC component
    • PTS system maltose-specific EIICB component
    • pseudogene
    • PTS family arbutin-salicin-cellobiose (ASC) porter component IIBC
    • PTS family porter, IIBC component
    • PTS system, alpha-glucoside-specific IIBC component domain protein
    • PTS system, alpha-glucoside-specific IIBC subunit
    • PTS system, maltose and glucose-specific IIC
    • PTS system arbutin-like IIBC component
    • PTS system glucose-specific IIBC component
    • PTS system maltose and glucose-specific transporter subunit IIBC
    • PTS system protein
  • strand?: -
  • coordinates?: 5888792..5890396
  • synteny block?: BlockID0045480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2114 (glvC)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2262 (glvC)
    08BA02176:
    C248_2365
    11819-97:
    MS7_2340
    71193:
    ST398NM01_2374
    ECT-R 2:
    ECTR2_2182
    ED133:
    SAOV_2363c
    ED98:
    SAAV_2385
    HO 5096 0412:
    SAEMRSA15_22210
    JH1:
    SaurJH1_2390
    JH9:
    SaurJH9_2347
    JKD6008:
    SAA6008_02359
    JKD6159:
    SAA6159_02227
    LGA251:
    SARLGA251_21060
    M013:
    M013TW_2280
    MRSA252:
    SAR2408
    MSHR1132:
    SAMSHR1132_21480
    MSSA476:
    SAS2216
    Mu3:
    SAHV_2307 (glvC)
    Mu50:
    SAV2323 (glvC)
    MW2:
    MW2244 (glvC)
    RF122:
    SAB2200c
    ST398:
    SAPIG2374
    T0131:
    SAT0131_02505
    TCH60:
    HMPREF0772_10872 (glvC)
    TW20:
    SATW20_24550
    USA300_TCH1516:
    USA300HOU_2303
    VC40:
    SAVC_10480

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNAIKRFGSAMIVPVLMFAFFGIVLGFATLFKNPTIMGSLADQHTFWFKFWSVIESGGWV
    N315            MNAIKRFGSAMIVPVLMFAFFGIVLGFATLFKNPTIMGSLADQHTFWFKFWSVIESGGWV
    NCTC8325        MNAIKRFGSAMIVPVLMFAFFGIVLGFATLFKNPTIMGSLADQHTFWFKFWSVIESGGWV
    Newman          MNAIKRFGSAMIVPVLMFAFFGIVLGFATLFKNPTIMGSLADQHTFWFKFWSVIESGGWV
    USA300_FPR3757  MNAIKRFGSAMIVPVLMFAFFGIVLGFATLFKNPTIMGSLADQHTFWFKFWSVIESGGWV
                    ************************************************************

    COL             IFTHMEVVFVVGLPLSLAKKAPGHAALAALMGYLMFNTFINAILTQWPHTFGANLEKGVE
    N315            IFTHMEVVFVVGLPLSLAKKAPGHAALAALMGYLMFNTFINAILTQWPHTFGANLEKGVE
    NCTC8325        IFTHMEVVFVVGLPLSLAKKAPGHAALAALMGYLMFNTFINAILTQWPHTFGANLEKGVE
    Newman          IFTHMEVVFVVGLPLSLAKKAPGHAALAALMGYLMFNTFINAILTQWPHTFGANLEKGVE
    USA300_FPR3757  IFTHMEVVFVVGLPLSLAKKAPGHAALAALMGYLMFNTFINAILTQWPHTFGANLEKGVE
                    ************************************************************

    COL             NVPGLKSIAGIATLDTNILGGIIISAIITWIHNRYYSKRLPEMVGVFQGLTFVVTISFFV
    N315            NVPGLKSIAGIATLDTNILGGIIISAIITWIHNRYYSKRLPEMVGVFQGLTFVVTISFFV
    NCTC8325        NVPGLKSIAGIATLDTNILGGIIISAIITWIHNRYYSKRLPEMVGVFQGLTFVVTISFFV
    Newman          NVPGLKSIAGIATLDTNILGGIIISAIITWIHNRYYSKRLPEMVGVFQGLTFVVTISFFV
    USA300_FPR3757  NVPGLKSIAGIATLDTNILGGIIISAIITWIHNRYYSKRLPEMVGVFQGLTFVVTISFFV
                    ************************************************************

    COL             MLPLAAITCVIWPTVQHGIGSMQHFIIASGYIGVWLYHFLERVLIPTGLHHFIYAPIEVG
    N315            MLPLAAITCVIWPTVQHGIGSMQHFIIASGYIGVWLYHFLERVLIPTGLHHFIYAPIEVG
    NCTC8325        MLPLAAITCVIWPTVQHGIGSMQHFIIASGYIGVWLYHFLERVLIPTGLHHFIYAPIEVG
    Newman          MLPLAAITCVIWPTVQHGIGSMQHFIIASGYIGVWLYHFLERVLIPTGLHHFIYAPIEVG
    USA300_FPR3757  MLPLAAITCVIWPTVQHGIGSMQHFIIASGYIGVWLYHFLERVLIPTGLHHFIYAPIEVG
                    ************************************************************

    COL             PVVVNHGLKAEWLQHLNEFAKSTKPLKEQFPYGFMLQGNGKVFGCLGIALAMYATTPKEN
    N315            PVVVNHGLKAEWLQHLNEFAKSTKPLKEQFPYGFMLQGNGKVFGCLGIALAMYATTPKEN
    NCTC8325        PVVVNHGLKAEWLQHLNEFAKSTKPLKEQFPYGFMLQGNGKVFGCLGIALAMYATTPKEN
    Newman          PVVVNHGLKAEWLQHLNEFAKSTKPLKEQFPYGFMLQGNGKVFGCLGIALAMYATTPKEN
    USA300_FPR3757  PVVVNHGLKAEWLQHLNEFAKSTKPLKEQFPYGFMLQGNGKVFGCLGIALAMYATTPKEN
                    ************************************************************

    COL             RKKVAALLIPATLTAVVVGITEPLEFTFLFIAPYLFVLHAVLAASMDTLMYAFGVVGNMG
    N315            RKKVAALLIPATLTAVVVGITEPLEFTFLFIAPYLFVLHAVLAASMDTLMYAFGVVGNMG
    NCTC8325        RKKVAALLIPATLTAVVVGITEPLEFTFLFIAPYLFVLHAVLAASMDTLMYAFGVVGNMG
    Newman          RKKVAALLIPATLTAVVVGITEPLEFTFLFIAPYLFVLHAVLAASMDTLMYAFGVVGNMG
    USA300_FPR3757  RKKVAALLIPATLTAVVVGITEPLEFTFLFIAPYLFVLHAVLAASMDTLMYAFGVVGNMG
                    ************************************************************

    COL             GGLLDFISTNWLPLGKEHWGTYVAQVIIGLIFVAIYFFLFRFLILKFDIPLPGRKKTEEE
    N315            GGLLDFISTNWLPLGKEHWGTYVAQVIIGLIFVAIYFFLFRFLILKFDIPLPGRKKTEEE
    NCTC8325        GGLLDFISTNWLPLGKEHWGTYVAQVIIGLIFVAIYFFLFRFLILKFDIPLPGRKKTEEE
    Newman          GGLLDFISTNWLPLGKEHWGTYVAQVIIGLIFVAIYFFLFRFLILKFDIPLPGRKKTEEE
    USA300_FPR3757  GGLLDFISTNWLPLGKEHWGTYVAQVIIGLIFVAIYFFLFRFLILKFDIPLPGRKKTEEE
                    ************************************************************

    COL             VKLFSKQDYKNKKGDSVDSKRASSGNEYEDKAAYYLDGLGGKENIKDVTNCTTRLRLTVY
    N315            VKLFSKQDYKNKKGDSVDSKRASTGNEYEDKAAYYLDGLGGKENIKDVTNCTTRLRLTVY
    NCTC8325        VKLFSKQDYKNKKGDSVDSKRASSGNEYEDKAAYYLDGLGGKENIKDVTNCTTRLRLTVY
    Newman          VKLFSKQDYKNKKGDSVDSKRASSGNEYEDKAAYYLDGLGGKENIKDVTNCTTRLRLTVY
    USA300_FPR3757  VKLFSKQDYKNKKGDSVDSKRASSGNEYEDKAAYYLDGLGGKENIKDVTNCTTRLRLTVY
                    ***********************:************************************

    COL             DESKVADTEYFTHQQMAHGLVKSGKSIQVVVGMTVPQVREAFEQMVEDQSPEDK
    N315            DESKVADTEYFTHQQMAHGLVKSGKSIQVVVGMTVPQVREAFEQMVEDQSSEDK
    NCTC8325        DESKVADTEYFTHQQMAHGLVKSGKSIQVVVGMTVPQVREAFEQMVEDQSSEDK
    Newman          DESKVADTEYFTHQQMAHGLVKSGKSIQVVVGMTVPQVREAFEQMVEDQSPEDK
    USA300_FPR3757  DESKVADTEYFTHQQMAHGLVKSGKSIQVVVGMTVPQVREAFEQMVEDQSSEDK
                    **************************************************.***