From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005822000
  • symbol?: hutG
  • description?: formimidoylglutamase

      descriptions from strain specific annotations:

    • formimidoylglutamase
    • Formiminoglutamase
    • arginase family protein
  • strand?: -
  • coordinates?: 5908703..5909638
  • synteny block?: BlockID0045670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2327 (hutG)
    N315:
    NCTC8325:
    Newman:
    NWMN_2235 (hutG)
    USA300_FPR3757:
    04-02981:
    SA2981_2273
    08BA02176:
    C248_2376 (hutG)
    11819-97:
    MS7_2351 (hutG)
    71193:
    ST398NM01_2385
    ECT-R 2:
    ECTR2_2194 (hutG)
    ED133:
    SAOV_2374c
    ED98:
    SAAV_2398 (hutG)
    HO 5096 0412:
    SAEMRSA15_22310
    JH1:
    SaurJH1_2402
    JH9:
    SaurJH9_2359
    JKD6008:
    SAA6008_02371 (hutG)
    JKD6159:
    SAA6159_02238 (hutG)
    LGA251:
    SARLGA251_21170
    M013:
    M013TW_2291
    MRSA252:
    SAR2420
    MSHR1132:
    SAMSHR1132_21590
    MSSA476:
    SAS2226
    Mu3:
    SAHV_2318
    Mu50:
    SAV2334
    MW2:
    MW2254
    RF122:
    SAB2211c (hutG)
    ST398:
    SAPIG2385 (hutG)
    T0131:
    SAT0131_02518
    TCH60:
    HMPREF0772_10860 (hutG)
    TW20:
    SATW20_24660
    USA300_TCH1516:
    USA300HOU_2314 (hutG)
    VC40:
    SAVC_10535

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYKQGEPNLWTGRLDSETDPKKFRHFQTVTFEDLSKLEKSSMPSGVGILGYAVDKGVALN
    N315            MYKQGEPNLWTGRLDSETDPKKFRHFQTVTFEDLSKLEKSSMPSGVGILGYAVDKGVALN
    NCTC8325        MYKQGEPNLWTGRLDSETDPKKFRHFQTVTFEDLSKLEKSSMPSGVGILGYAVDKGVALN
    Newman          MYKQGEPNLWTGRLDSETDPKKFRHFQTVTFEDLSKLEKSSMPSGVGILGYAVDKGVALN
    USA300_FPR3757  MYKQGEPNLWTGRLDSETDPKKFRHFQTVTFEDLSKLEKSSMPSGVGILGYAVDKGVALN
                    ************************************************************

    COL             KGRIGAKEGPDAIKQAFAGLPDLNQCETLVDYGNVYHDHEELIDTQKEFAMLAAKSIANH
    N315            KGRIGAKEGPDAIKQAFAGLPDLNQCETLVDYGNVYHDHEELIDTQKEFAMLAAKSIANH
    NCTC8325        KGRIGAKEGPDAIKQAFAGLPDLNQCETLVDYGNVYHDHEELIDTQKEFAMLAAKSIANH
    Newman          KGRIGAKEGPDAIKQAFAGLPDLNQCETLVDYGNVYHDHEELIDTQKEFAMLAAKSIANH
    USA300_FPR3757  KGRIGAKEGPDAIKQAFAGLPDLNQCETLVDYGNVYHDHEELIDTQKEFAMLAAKSIANH
                    ************************************************************

    COL             RQTFLLGGGHDIAYAQYLATRKVYPTQSIGVINIDAHFDTRAEQQSTSGTSFRQILEEDE
    N315            RQTFLLGGGHDIAYAQYLATRKVYPTQSIGVINIDAHFDTRAEQQSTSGTSFRQILEEDE
    NCTC8325        RQTFLLGGGHDIAYAQYLATRKVYPTQSIGVINIDAHFDTRAEQQSTSGTSFRQILEEDE
    Newman          RQTFLLGGGHDIAYAQYLATRKVYPTQSIGVINIDAHFDTRAEQQSTSGTSFRQILEEDE
    USA300_FPR3757  RQTFLLGGGHDIAYAQYLATRKVYPTQSIGVINIDAHFDTRAEQQSTSGTSFRQILEEDE
                    ************************************************************

    COL             NTDYLVLGIAQGGNTQSLFDYAKEKKIDYVFADELLSHVSPTIKDMIERFVHEHDVIMFT
    N315            NTDYLVLGIAQGGNTQSLFDYAKEKKIDYVFADELLSHVSPTIKDMIERFVHEHDVIMFT
    NCTC8325        NTDYLVLGIAQGGNTQSLFDYAKEKKIDYVFADELLSHVSPTIKDMIERFVHEHDVIMFT
    Newman          NTDYLVLGIAQGGNTQSLFDYAKEKKIDYVFADELLSHVSPTIKDMIERFVHEHDVIMFT
    USA300_FPR3757  NTDYLVLGIAQGGNTQSLFDYAKEKKIDYVFADELLSHVSPTIKDMIERFVHEHDVIMFT
                    ************************************************************

    COL             ICMDVIDSAFAPGVSAPAVLGLYPHTVLELAKRIIPSDKVSSVSIAEMNPTYDADNRTAK
    N315            ICMDVIDSAFAPGVSAPAVLGLYPHTVLELAKRIIPSDKVSSVSIAEMNPTYDADNRTAK
    NCTC8325        ICMDVIDSAFAPGVSAPAVLGLYPHTVLELAKRIIPSDKVSSVSIAEMNPTYDADNRTAK
    Newman          ICMDVIDSAFAPGVSAPAVLGLYPHTVLELAKRIIPSDKVSSVSIAEMNPTYDADNRTAK
    USA300_FPR3757  ICMDVIDSAFAPGVSAPAVLGLYPHTVLELAKRIIPSDKVSSVSIAEMNPTYDADNRTAK
                    ************************************************************

    COL             LVANLVHHFLK
    N315            LVANLVHHFLK
    NCTC8325        LVANLVHHFLK
    Newman          LVANLVHHFLK
    USA300_FPR3757  LVANLVHHFLK
                    ***********