From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005823000
  • symbol?: lyrA
  • description?: metal-dependent membrane protease

      descriptions from strain specific annotations:

    • metal-dependent membrane protease
    • CAAX amino terminal protease family protein
    • lysostaphin resistance protein A
    • membrane protein
    • abortive infection protein
    • Lysostaphin resistance protein A, lyrA
  • strand?: +
  • coordinates?: 5909928..5911199
  • synteny block?: BlockID0045680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2274
    08BA02176:
    C248_2377 (lyrA)
    11819-97:
    MS7_2353 (lyrA)
    71193:
    ST398NM01_2387
    ECT-R 2:
    ECTR2_2195
    ED133:
    SAOV_2375
    ED98:
    SAAV_2399
    HO 5096 0412:
    SAEMRSA15_22320
    JH1:
    SaurJH1_2403
    JH9:
    SaurJH9_2360
    JKD6008:
    SAA6008_02373
    JKD6159:
    SAA6159_02239
    LGA251:
    SARLGA251_21180
    M013:
    M013TW_2292
    MRSA252:
    SAR2421
    MSHR1132:
    SAMSHR1132_21600
    MSSA476:
    SAS2227
    Mu3:
    SAHV_2319
    Mu50:
    SAV2335
    MW2:
    MW2255
    RF122:
    SAB2212
    ST398:
    SAPIG2387
    T0131:
    SAT0131_02520 (cysJ)
    TCH60:
    HMPREF0772_10859
    TW20:
    SATW20_24670
    USA300_TCH1516:
    USA300HOU_2315
    VC40:
    SAVC_10540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNNKISGFQWAMTIFVFFVITMALSIMLRDFQSIIGVKHFIFEVTDLAPLIAAIICILV
    N315            MKNNKISGFQWAMTIFVFFVITMALSIMLRDFQSIIGVKHFIFEVTDLAPLIAAIICILV
    NCTC8325        MKNNKISGFQWAMTIFVFFVITMALSIMLRDFQSIIGVKHFIFEVTDLAPLIAAIICILV
    Newman          MKNNKISGFQWAMTIFVFFVITMALSIMLRDFQSIIGVKHFIFEVTDLAPLIAAIICILV
    USA300_FPR3757  MKNNKISGFQWAMTIFVFFVITMALSIMLRDFQSIIGVKHFIFEVTDLAPLIAAIICILV
                    ************************************************************

    COL             FKYKKVQLAGLKFSISLKVIERLLLALILPLIILIIGMYSFNTFADSFILLQSTGLSVPI
    N315            FKYKKVQLAGLKFSISLKVIERLLLALILPLIILIIGMYSFNTFADSFILLQSTGLSVPI
    NCTC8325        FKYKKVQLAGLKFSISLKVIERLLLALILPLIILIIGMYSFNTFADSFILLQSTGLSVPI
    Newman          FKYKKVQLAGLKFSISLKVIERLLLALILPLIILIIGMYSFNTFADSFILLQSTGLSVPI
    USA300_FPR3757  FKYKKVQLAGLKFSISLKVIERLLLALILPLIILIIGMYSFNTFADSFILLQSTGLSVPI
                    ************************************************************

    COL             THILIGHILMAFVVEFGFRSYLQNIVETKMNTFFASIVVGLMYSVFSANTTYGTEFAAYN
    N315            THILIGHILMAFVVEFGFRSYLQNIVETKMNTFFASIVVGLMYSVFSANTTYGTEFAAYN
    NCTC8325        THILIGHILMAFVVEFGFRSYLQNIVETKMNTFFASIVVGLMYSVFSANTTYGTEFAAYN
    Newman          THILIGHILMAFVVEFGFRSYLQNIVETKMNTFFASIVVGLMYSVFSANTTYGTEFAAYN
    USA300_FPR3757  THILIGHILMAFVVEFGFRSYLQNIVETKMNTFFASIVVGLMYSVFSANTTYGTEFAAYN
                    ************************************************************

    COL             FLYTFSFSMILGELIRATKGRTIYIATTFHASMTFGLIFLFSEEIGDLFSIKVIAISTAI
    N315            FLYTFSFSMILGELIRATKGRTIYIATTFHASMTFGLIFLFSEEIGDLFSIKVIAISTAI
    NCTC8325        FLYTFSFSMILGELIRATKGRTIYIATTFHASMTFGLIFLFSEEIGDLFSIKVIAISTAI
    Newman          FLYTFSFSMILGELIRATKGRTIYIATTFHASMTFGLIFLFSEEIGDLFSIKVIAISTAI
    USA300_FPR3757  FLYTFSFSMILGELIRATKGRTIYIATTFHASMTFGLIFLFSEEIGDLFSIKVIAISTAI
                    ************************************************************

    COL             VAVGYIGLSLIIRGIAYLTTRRNLEELEPNNYLDHVNDDEETNHTEAEKSSSNIKDAEKT
    N315            VAVGYIGLSLIIRGIAYLTTRRNLEELEPNNYLDHVNDDEETNHTEAEKSSSNIKDAEKT
    NCTC8325        VAVGYIGLSLIIRGIAYLTTRRNLEELEPNNYLDHVNDDEETNHTEAEKSSSNIKDAEKT
    Newman          VAVGYIGLSLIIRGIAYLTTRRNLEELEPNNYLDHVNDDEETNHTEAEKSSSNIKDAEKT
    USA300_FPR3757  VAVGYIGLSLIIRGIAYLTTRRNLEELEPNNYLDHVNDDEETNHTEAEKSSSNIKDAEKT
                    ************************************************************

    COL             GVATASTVGVAKNDTENTVADEPSIHEGTEKTEPQHHIGNQTESNHDEDHDITSESVESA
    N315            GVATASTVGVAKNDTENTVADEPSIHEGTEKTEPQHHIGNQTESNHDEDHDITSESVESA
    NCTC8325        GVATASTVGVAKNDTENTVADEPSIHEGTEKTEPQHHIGNQTESNHDEDHDITSESVESA
    Newman          GVATASTVGVAKNDTENTVADEPSIHEGTEKTEPQHHIGNQTESNHDEDHDITSESVESA
    USA300_FPR3757  GVATASTVGVAKNDTENTVADEPSIHEGTEKTEPQHHIGNQTESNHDEDHDITSESVESA
                    ************************************************************

    COL             ESVKQAPQSDDLTNDSNEDEIEQSLKEPVTYKEDRRSSVVIDAEKHIEKTEEQSSDKNK
    N315            ESVKQAPQSDDLTNDSNEDEIEQSLKEPATYKEDRRSSVVIDAEKHIEKTEEQSSDKNK
    NCTC8325        ESVKQAPQSDDLTNDSNEDEIEQSLKEPATYKEDRRSSVVIDAEKHIEKTEEQSSDKNK
    Newman          ESVKQAPQSDDLTNDSNEDEIEQSLKEPVTYKEDRRSSVVIDAEKHIEKTEEQSSDKNK
    USA300_FPR3757  ESVKQAPQSDDLTNDSNEDEIEQSLKEPATYKEDRRSSVVIDAEKHIEKTEEQSSDKNK
                    ****************************.******************************