From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005826000
  • symbol?:
  • description?: MOSC domain-containing protein

      descriptions from strain specific annotations:

    • MOSC domain-containing protein
    • mosc domain protein
    • Molybdenum cofactor sulfurase
  • strand?: +
  • coordinates?: 5912125..5912778
  • synteny block?: BlockID0045710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2276
    08BA02176:
    C248_2379
    11819-97:
    MS7_2355
    71193:
    ST398NM01_2389
    ECT-R 2:
    ECTR2_2197
    ED133:
    SAOV_2377
    ED98:
    SAAV_2401
    HO 5096 0412:
    SAEMRSA15_22340
    JH1:
    SaurJH1_2405
    JH9:
    SaurJH9_2362
    JKD6008:
    SAA6008_02375
    JKD6159:
    SAA6159_02241
    LGA251:
    SARLGA251_21200
    M013:
    M013TW_2294
    MRSA252:
    SAR2423
    MSHR1132:
    SAMSHR1132_21620
    MSSA476:
    SAS2229
    Mu3:
    SAHV_2321
    Mu50:
    SAV2337
    MW2:
    MW2257
    RF122:
    SAB2214
    ST398:
    SAPIG2389
    T0131:
    SAT0131_02522
    TCH60:
    HMPREF0772_10857
    TW20:
    SATW20_24690
    USA300_TCH1516:
    USA300HOU_2317
    VC40:
    SAVC_10550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MISIHAISTGKIQDLPYSSKRPMRSALDKTKISQTTWLSSTGFTGDEQAYKDHGGPHKAV
    N315            MISIHAISTGKIQDLPYSSKRPIRSALDKTKISQTTWLSSTGFTGDEQAYKDHGGPHKAV
    NCTC8325        MISIHAISTGKIQDLPYSSKRPMRSALDKTKISQTTWLSSTGFTGDEQAYKDHGGPHKAV
    Newman          MISIHAISTGKIQDLPYSSKRPMRSALDKTKISQTTWLSSTGFTGDEQAYKDHGGPHKAV
    USA300_FPR3757  MISIHAISTGKIQDLPYSSKRPMRSALDKTKISQTTWLSSTGFTGDEQAYKDHGGPHKAV
                    **********************:*************************************

    COL             CGFSKHNYALYQDDLPTLPTHAMFGENLTFDYLDESDVYFGNQYRLGEALIEVSEIREPC
    N315            CGFSKHNYALYQDDLPTLPTHAMFGENLTFDYLDESDVYFGNQYRLGEALIEVSEIREPC
    NCTC8325        CGFSKHNYALYQDDLPTLPTHAMFGENLTFDYLDESDVYFGNQYRLGEALIEVSEIREPY
    Newman          CGFSKHNYALYQDDLPTLPTHAMFGENLTFDYLDESDVYFGNQYRLGEALIEVSEIREPC
    USA300_FPR3757  CGFSKHNYALYQDDLPTLPTHAMFGENLTFDYLDESDVYFGNQYRLGEALIEVSEIREPC
                    *********************************************************** 

    COL             WKIQAKYNIPDLVKRMSTSGKTGFYFRVLKQGYVSPNDQLYLIQEAPIEHRLSVQQLNDL
    N315            WKIQAKYNIPDLVKRMSTSGKTGFYFRVLKQGYVSPNDQLYLIQEAPIEHRLSVQQLNDL
    NCTC8325        WKIQAKYNIPDLVKRMSTSGKTGFYFRVLKQGYVSPNDQLYLIQEAPIEHRLSVQQLNDL
    Newman          WKIQAKYNIPDLVKRMSTSGKTGFYFRVLKQGYVSPNDQLYLIQEAPIEHRLSVQQLNDL
    USA300_FPR3757  WKIQAKYNIPDLVKRMSTSGKTGFYFRVLKQGYVSPNDQLYLIQEAPIEHRLSVQQLNDL
                    ************************************************************

    COL             YYNDRQNQDMLRYALNNPFLSPTRRDKLQKMYNRTLK
    N315            YYNDRQNQDMLRYALNNPFLSPTRRDKLQKMYNRTLK
    NCTC8325        YYNDRQNQDMLRYALNNPFLSPTRRDKLQKMYNRTLK
    Newman          YYNDRQNQDMLRYALNNPFLSPTRRDKLQKMYNRTLK
    USA300_FPR3757  YYNDRQNQDMLRYALNNPFLSPTRRDKLQKMYNRTLK
                    *************************************