From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005829000
  • symbol?: galM
  • description?: galactose mutarotase

      descriptions from strain specific annotations:

    • galactose mutarotase
    • aldose 1-epimerase
    • aldose 1-epimerase precursor
    • aldose 1-epimerase family protein
    • aldose 1-epimerase subfamily
    • putative aldose 1-epimerase
  • strand?: -
  • coordinates?: 5913109..5914128
  • synteny block?: BlockID0045740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2332 (galM)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2277
    08BA02176:
    C248_2381
    11819-97:
    MS7_2357
    71193:
    ST398NM01_2391
    ECT-R 2:
    ECTR2_2199
    ED133:
    SAOV_2379c
    ED98:
    SAAV_2403 (galM)
    HO 5096 0412:
    SAEMRSA15_22350
    JH1:
    SaurJH1_2407
    JH9:
    SaurJH9_2363
    JKD6008:
    SAA6008_02376 (galM)
    JKD6159:
    SAA6159_02242 (galM)
    LGA251:
    SARLGA251_21210
    M013:
    M013TW_2295
    MRSA252:
    SAR2424
    MSHR1132:
    SAMSHR1132_21630
    MSSA476:
    SAS2230
    Mu3:
    SAHV_2322
    Mu50:
    SAV2338
    MW2:
    MW2258
    RF122:
    SAB2215c
    ST398:
    SAPIG2391
    T0131:
    SAT0131_02524
    TCH60:
    HMPREF0772_10856 (galM)
    TW20:
    SATW20_24700
    USA300_TCH1516:
    USA300HOU_2319
    VC40:
    SAVC_10555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
    N315            MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
    NCTC8325        MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
    Newman          MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
    USA300_FPR3757  MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
                    ************************************************************

    COL             KFGASIGRYSGRIDNAKFKLKGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
    N315            KFGASIGRYSGRIDNAKFKLKGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
    NCTC8325        KFGASIGRYSGRIDNAKFKLKGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
    Newman          KFGASIGRYSGRIDNAKFKLKGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
    USA300_FPR3757  KFGASIGRYSGRIDNAKFKLKGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
                    ************************************************************

    COL             VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPTNHVYFNLNRDN
    N315            VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPMNHVYFNLNRDN
    NCTC8325        VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPTNHVYFNLNRDN
    Newman          VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPTNHVYFNLNRDN
    USA300_FPR3757  VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPTNHVYFNLNRDN
                    ************************************************ ***********

    COL             NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
    N315            NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
    NCTC8325        NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
    Newman          NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
    USA300_FPR3757  NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
                    ************************************************************

    COL             GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
    N315            GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
    NCTC8325        GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
    Newman          GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
    USA300_FPR3757  GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
                    ************************************************************

    COL             QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
    N315            QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
    NCTC8325        QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
    Newman          QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
    USA300_FPR3757  QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
                    ***************************************