From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005831000
  • symbol?:
  • description?: YnfA family protein

      descriptions from strain specific annotations:

    • YnfA family protein
    • membrane protein
    • membrane associated protein
  • strand?: -
  • coordinates?: 5914158..5914358
  • synteny block?: BlockID0045760
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2278
    08BA02176:
    C248_2382
    11819-97:
    MS7_2358
    71193:
    ST398NM01_2392
    ECT-R 2:
    ECTR2_2200
    ED133:
    SAOV_2380c
    ED98:
    SAAV_2404
    HO 5096 0412:
    SAEMRSA15_22360
    JH1:
    SaurJH1_2408
    JH9:
    SaurJH9_2364
    JKD6008:
    SAA6008_02377 (ynfA)
    JKD6159:
    SAA6159_02243 (ynfA)
    LGA251:
    SARLGA251_21220
    M013:
    MRSA252:
    SAR2425
    MSHR1132:
    SAMSHR1132_21640
    MSSA476:
    SAS2231
    Mu3:
    SAHV_2323
    Mu50:
    SAV2339
    MW2:
    MW2259
    RF122:
    SAB2216c
    ST398:
    T0131:
    SAT0131_02525
    TCH60:
    HMPREF0772_10855
    TW20:
    SATW20_24710
    USA300_TCH1516:
    USA300HOU_2320
    VC40:
    SAVC_10560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV
    N315            MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV
    NCTC8325        MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV
    Newman          MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV
    USA300_FPR3757  MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV
                    ************************************************************

    COL             YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA
    N315            YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA
    NCTC8325        YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA
    Newman          YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA
    USA300_FPR3757  YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA
                    ************************************************