From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005835000
  • symbol?:
  • description?: sodium ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • sodium ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter
    • ABC transporter ATPase
    • ABC transporter family protein
    • ABC-type transport system, ATPase component
    • Sodium export ATP-binding protein
  • strand?: -
  • coordinates?: 5915928..5916827
  • synteny block?: BlockID0045800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2280
    08BA02176:
    C248_2384
    11819-97:
    MS7_2360
    71193:
    ST398NM01_2394
    ECT-R 2:
    ECTR2_2202
    ED133:
    SAOV_2383c
    ED98:
    SAAV_2406
    HO 5096 0412:
    SAEMRSA15_22380
    JH1:
    SaurJH1_2411
    JH9:
    SaurJH9_2366
    JKD6008:
    SAA6008_02379
    JKD6159:
    SAA6159_02245
    LGA251:
    SARLGA251_21240
    M013:
    M013TW_2299
    MRSA252:
    SAR2427
    MSHR1132:
    SAMSHR1132_21660
    MSSA476:
    SAS2233
    Mu3:
    SAHV_2325
    Mu50:
    SAV2341
    MW2:
    MW2261
    RF122:
    SAB2219c
    ST398:
    SAPIG2394
    T0131:
    SAT0131_02528
    TCH60:
    HMPREF0772_10852
    TW20:
    SATW20_24730
    USA300_TCH1516:
    USA300HOU_2323
    VC40:
    SAVC_10570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGLVIEHVTKRFGKMTAVNDISLKLESGKMLGFLGRNGAGKTTTFRMILGLSEPTEGHIT
    N315            MGLVIEHVTKRFGKMTAVNDISLELESGKMLGFLGRNGAGKTTTFRMILGLSEPTEGHIT
    NCTC8325        MGLVIEHVTKRFGKMTAVNDISLKLESGKMLGFLGRNGAGKTTTFRMILGLSEPTEGHIT
    Newman          MGLVIEHVTKRFGKMTAVNDISLKLESGKMLGFLGRNGAGKTTTFRMILGLSEPTEGHIT
    USA300_FPR3757  MGLVIEHVTKRFGKMTAVNDISLKLESGKMLGFLGRNGAGKTTTFRMILGLSEPTEGHIT
                    ***********************:************************************

    COL             YNGKKLDKTMYNRIGYLPEERGLHGKLTVEEELKYLATLKGMSKTEIQQQISYWLERFDI
    N315            YNGKKLDKTMYNRIGYLPEERGLHGKLTVEEELKYLATLKGMSKTEIQQQISYWLERFDI
    NCTC8325        YNGKKLDKTMYNRIGYLPEERGLHGKLTVEEELKYLATLKGMSKTEIQQQISYWLERFDI
    Newman          YNGKKLDKTMYNRIGYLPEERGLHGKLTVEEELKYLATLKGMSKTEIQQQISYWLERFDI
    USA300_FPR3757  YNGKKLDKTMYNRIGYLPEERGLHGKLTVEEELKYLATLKGMSKTEIQQQISYWLERFDI
                    ************************************************************

    COL             TENRKKRIDSLSKGNQQKIQLLASMLHKPELLILDEPFSGLDPVNVELLKEAVKDLNDWG
    N315            TENRKKRIDSLSKGNQQKIQLLASMLHKPELLILDEPFSGLDPVNVELLKEAVKDLNDWG
    NCTC8325        TENRKKRIDSLSKGNQQKIQLLASMLHKPELLILDEPFSGLDPVNVELLKEAVKDLNDWG
    Newman          TENRKKRIDSLSKGNQQKIQLLASMLHKPELLILDEPFSGLDPVNVELLKEAVKDLNDWG
    USA300_FPR3757  TENRKKRIDSLSKGNQQKIQLLASMLHKPELLILDEPFSGLDPVNVELLKEAVKDLNDWG
                    ************************************************************

    COL             STIVYSSHRMEHVEELCDDVCILDKGQLVVSGDINHVRASNGNKKVVIESETTLPDLTNI
    N315            STIVYSSHRMEHVEELCDDVCILDKGQLVVSGDINHVRASNGNKKVVIESETTLPDLTNI
    NCTC8325        STIVYSSHRMEHVEELCDDVCILDKGQLVVSGDINHVRASNGNKKVVIESETTLPDLTNI
    Newman          STIVYSSHRMEHVEELCDDVCILDKGQLVVSGDINHVRASNGNKKVVIESETTLPDLTNI
    USA300_FPR3757  STIVYSSHRMEHVEELCDDVCILDKGQLVVSGDINHVRASNGNKKVVIESETTLPDLTNI
                    ************************************************************

    COL             RGIIHSENMKQGLQLTIENEDVAKDIYQVVAHQGYVKRFQVVEPSLQDIFIEKVGGKDA
    N315            RGIIHSENMKQGLQLTIENEDVAKDIYQVVAHQGYVKRFQVVEPSLQDIFIEKVGGKDA
    NCTC8325        RGIIHSENMKQGLQLTIENEDVAKDIYQVVAHQGYVKRFQVVEPSLQDIFIEKVGGKDA
    Newman          RGIIHSENMKQGLQLTIENEDVAKDIYQVVAHQGYVKRFQVVEPSLQDIFIEKVGGKDA
    USA300_FPR3757  RGIIHSENMKQGLQLTIENEDVAKDIYQVVAHQGYVKRFQVVEPSLQDIFIEKVGGKDA
                    ***********************************************************