From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005837000
  • symbol?:
  • description?: DUF805 domain-containing protein

      descriptions from strain specific annotations:

    • DUF805 domain-containing protein
    • integral membrane protein
  • strand?: -
  • coordinates?: 5917063..5917710
  • synteny block?: BlockID0045820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2281
    08BA02176:
    C248_2385
    11819-97:
    MS7_2361
    71193:
    ST398NM01_2395
    ECT-R 2:
    ECTR2_2203
    ED133:
    SAOV_2384c
    ED98:
    SAAV_2407
    HO 5096 0412:
    SAEMRSA15_22390
    JH1:
    SaurJH1_2412
    JH9:
    SaurJH9_2367
    JKD6008:
    SAA6008_02380
    JKD6159:
    SAA6159_02246
    LGA251:
    SARLGA251_21250
    M013:
    M013TW_2300
    MRSA252:
    SAR2428
    MSHR1132:
    SAMSHR1132_21670
    MSSA476:
    SAS2234
    Mu3:
    SAHV_2326
    Mu50:
    SAV2342
    MW2:
    MW2263
    RF122:
    SAB2220c
    ST398:
    SAPIG2395
    T0131:
    SAT0131_02529
    TCH60:
    HMPREF0772_10851
    TW20:
    SATW20_24740
    USA300_TCH1516:
    USA300HOU_2324
    VC40:
    SAVC_10575

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQLPQVGFMKSFVLFWKNYVNFKGRSRRSEYWYMALWHLILMVPAVCVLIINLFLFFIS
    N315            MEQLPQVGFMKSFVLFWKNYVNFKGRSRRSEYWYMALWHLILMVPAVCVLIINLFLVFIS
    NCTC8325        MEQLPQVGFMKSFVLFWKNYVNFKGRSRRSEYWYMALWHLILMVPAVCVLIINLFLFFIS
    Newman          MEQLPQVGFMKSFVLFWKNYVNFKGRSRRSEYWYMALWHLILMVPAVCVLIINLFLFFIS
    USA300_FPR3757  MEQLPQVGFMKSFVLFWKNYVNFKGRSRRSEYWYMALWHLILMVPAVCVLIINLFLFFIS
                    ********************************************************.***

    COL             IAADNETLIVMSILMIILTSVYTFVYSLATFIPNLALCVRRFHDISRTMLFPMIMTVFSI
    N315            IAADNETLIVMSILMIILTSVYTFVYSLATFIPNLALCVRRFHDISRTMLFPMIMTVFSI
    NCTC8325        IAADNETLIVMSILMIILTSVYTFVYSLATFIPNLALCVRRFHDISRTMLFPMIMTVFSI
    Newman          IAADNETLIVMSILMIILTSVYTFVYSLATFIPNLALCVRRFHDISRTMLFPMIMTVFSI
    USA300_FPR3757  IAADNETLIVMSILMIILTSVYTFVYSLATFIPNLALCVRRFHDISRTMLFPMIMTVFSI
                    ************************************************************

    COL             IFYIVLQIIDSYYDSDFTLMPMGLNILLVLLYFVYLGLTIVMIVFLCFDSKPANKYGESP
    N315            IFYIVLQIIDSYYDSDFTLMPMGLNILLVLLYFVYLGLTIVMIVFLCFDSKPANKYGESP
    NCTC8325        IFYIVLQIIDSYYDSDFTLMPMGLNILLVLLYFVYLGLTIVMIVFLCFDSKPANKYGESP
    Newman          IFYIVLQIIDSYYDSDFTLMPMGLNILLVLLYFVYLGLTIVMIVFLCFDSKPANKYGESP
    USA300_FPR3757  IFYIVLQIIDSYYDSDFTLMPMGLNILLVLLYFVYLGLTIVMIVFLCFDSKPANKYGESP
                    ************************************************************

    COL             KYPSTIKNQPVTSETPEKACTSETPKTPEETDNQL
    N315            KYPSTIKNQPV---------TSETPKTPEETDNQL
    NCTC8325        KYPSTIKNQPVTSETPEKACTSETPKTPEETDNQL
    Newman          KYPSTIKNQPVTSETPEKACTSETPKTPEETDNQL
    USA300_FPR3757  KYPSTIKNQPVTSETPEKACTSETPKTPEETDNQL
                    ***********         ***************