From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005846000
  • symbol?: corA
  • description?: divalent cation transport

      descriptions from strain specific annotations:

    • divalent cation transport
    • Mg2+ transporter protein, CorA family protein
    • Mg2 transporter protein CorA family protein
    • magnesium and cobalt transport protein CorA, putative
    • Magnesium and cobalt transport protein corA
    • corA-like Mg2+ transporter family protein
    • CorA-like Mg2+ transporter protein
    • MIT family metal ion transporter CorA
    • divalent cation transporter
  • strand?: -
  • coordinates?: 5923360..5924307
  • synteny block?: BlockID0045910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2286 (corA)
    08BA02176:
    C248_2390
    11819-97:
    MS7_2365 (corA)
    71193:
    ST398NM01_2399
    ECT-R 2:
    ECTR2_2207
    ED133:
    SAOV_2390c
    ED98:
    SAAV_2411
    HO 5096 0412:
    SAEMRSA15_22450
    JH1:
    SaurJH1_2417
    JH9:
    SaurJH9_2371
    JKD6008:
    SAA6008_02384 (corA)
    JKD6159:
    SAA6159_02251 (corA)
    LGA251:
    SARLGA251_21290
    M013:
    M013TW_2304
    MRSA252:
    SAR2432
    MSHR1132:
    SAMSHR1132_21710
    MSSA476:
    SAS2238
    Mu3:
    SAHV_2331
    Mu50:
    SAV2347
    MW2:
    MW2268
    RF122:
    SAB2226c
    ST398:
    SAPIG2399
    T0131:
    SAT0131_02533
    TCH60:
    HMPREF0772_10847 (corA)
    TW20:
    SATW20_24780
    USA300_TCH1516:
    USA300HOU_2328
    VC40:
    SAVC_10595

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALKIRYQTTYEPFKVVDDIKEIPKDATIVWYDFDEPNEQENEWFKAHFNFNDLEVDDAI
    N315            MALKIRYQTTYEPFKVVDDIKEIPKDATIVWYDFDEPNEQENEWFKAHFNFNDLEVDDAI
    NCTC8325        MALKIRYQTTYEPFKVVDDIKEIPKDATIVWYDFDEPNEQENEWFKAHFNFNDLEVDDAI
    Newman          MALKIRYQTTYEPFKVVDDIKEIPKDATIVWYDFDEPNEQENEWFKAHFNFNDLEVDDAI
    USA300_FPR3757  MALKIRYQTTYEPFKVVDDIKEIPKDATIVWYDFDEPNEQENEWFKAHFNFNDLEVDDAI
                    ************************************************************

    COL             NGMPRAKYKSYKDYQYLVFHSIMGSNYSPIALNIFIQDNVLVTYHHQTLESLNKVVYKYM
    N315            NGMPRAKYKSYKDYQYLVFHSIMGSNYSPIALNIFIQDNVLVTYHHQTLESLNKVVYKYM
    NCTC8325        NGMPRAKYKSYKDYQYLVFHSIMGSNYSPIALNIFIQDNVLVTYHHQTLESLNKVVYKYM
    Newman          NGMPRAKYKSYKDYQYLVFHSIMGSNYSPIALNIFIQDNVLVTYHHQTLESLNKVVYKYM
    USA300_FPR3757  NGMPRAKYKSYKDYQYLVFHSIMGSNYSPIALNIFIQDNVLVTYHHQTLESLNKVVYKYM
                    ************************************************************

    COL             NTLDAELDCADVVILILDMMVDKYFNFVYALEDSVYHFEDRHVDDRFNKMVMDSVFKLRS
    N315            NTLDAELDCADVVILILDMMVDKYFNFVYALEDSVYHFEDRHVDDRFNKMVMDSVFKLRS
    NCTC8325        NTLDAELDCADVVILILDMMVDKYFNFVYALEDSVYHFEDRHVDDRFNKMVMDSVFKLRS
    Newman          NTLDAELDCADVVILILDMMVDKYFNFVYALEDSVYHFEDRHVDDRFNKMVMDSVFKLRS
    USA300_FPR3757  NTLDAELDCADVVILILDMMVDKYFNFVYALEDSVYHFEDRHVDDRFNKMVMDSVFKLRS
                    ************************************************************

    COL             DLIKVKRVLFPMQELIDTMKQNGDLIIDNKHSLYIQHIDDHLIKQRNIIRTAQEMTNEIR
    N315            DLIKVKRVLFPMQELIDTMKQNGDLIIDNKHSLYIQHIDDHLIKQRNIIRTAQEMTNEIR
    NCTC8325        DLIKVKRVLFPMQELIDTMKQNGDLIIDNKHSLYIQHIDDHLIKQRNIIRTAQEMTNEIR
    Newman          DLIKVKRVLFPMQELIDTMKQNGDLIIDNKHSLYIQHIDDHLIKQRNIIRTAQEMTNEIR
    USA300_FPR3757  DLIKVKRVLFPMQELIDTMKQNGDLIIDNKHSLYIQHIDDHLIKQRNIIRTAQEMTNEIR
                    ************************************************************

    COL             ENFESYTSFRMNSIMQVLTLVSVIFSPLTFIAGIYGMNFVNMPALHLHYGYYICLAVMFV
    N315            ENFESYTSFRMNSIMQVLTLVSVIFSPLTFIAGIYGMNFVNMPALHLHYGYYICLAVMFV
    NCTC8325        ENFESYTSFRMNSIMQVLTLVSVIFSPLTFIAGIYGMNFVNMPALHLHYGYYICLAVMFV
    Newman          ENFESYTSFRMNSIMQVLTLVSVIFSPLTFIAGIYGMNFVNMPALHLHYGYYICLAVMFV
    USA300_FPR3757  ENFESYTSFRMNSIMQVLTLVSVIFSPLTFIAGIYGMNFVNMPALHLHYGYYICLAVMFV
                    ************************************************************

    COL             IAVVLIIFFRRKKWF
    N315            IAVVLIIFFRRKKWF
    NCTC8325        IAVVLIIFFRRKKWF
    Newman          IAVVLIIFFRRKKWF
    USA300_FPR3757  IAVVLIIFFRRKKWF
                    ***************