From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005849000
  • symbol?:
  • description?: esterase

      descriptions from strain specific annotations:

    • esterase
    • esterase, putative
    • putative esterase
    • alpha/beta hydrolase fold family protein
    • alpha/beta hydrolase domain-containing protein
    • esterase-like protein
    • Alpha/beta hydrolase fold-3 domain-containing protein
    • alpha/beta hydrolase fold-3 domain protein
  • strand?: -
  • coordinates?: 5925425..5926285
  • synteny block?: BlockID0045940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2289
    08BA02176:
    C248_2393
    11819-97:
    MS7_2368
    71193:
    ST398NM01_2402
    ECT-R 2:
    ECTR2_2210
    ED133:
    SAOV_2393c
    ED98:
    SAAV_2414
    HO 5096 0412:
    SAEMRSA15_22480
    JH1:
    SaurJH1_2420
    JH9:
    SaurJH9_2374
    JKD6008:
    SAA6008_02387
    JKD6159:
    SAA6159_02254
    LGA251:
    SARLGA251_21320
    M013:
    M013TW_2307
    MRSA252:
    SAR2435
    MSHR1132:
    SAMSHR1132_21740
    MSSA476:
    SAS2241
    Mu3:
    SAHV_2334
    Mu50:
    SAV2350
    MW2:
    MW2271
    RF122:
    SAB2229c
    ST398:
    SAPIG2402
    T0131:
    SAT0131_02536
    TCH60:
    HMPREF0772_10844
    TW20:
    SATW20_24810
    USA300_TCH1516:
    USA300HOU_2331
    VC40:
    SAVC_10610

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------MNSVVNKYLLHNRSIMFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLS
    N315            MIRNRVMNSVVNKYLLHNRSIMFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLS
    NCTC8325        ------MNSVVNKYLLHNRSIMFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLS
    Newman          MIRNRVMNSVVNKYLLHNRSIMFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLS
    USA300_FPR3757  MIRNRVMNSVVNKYLLHNRSIMFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLS
                          ******************************************************

    COL             LDDMQVFRFNFRHQIDKKILYIHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPE
    N315            LDDMQVFRFNFRHQIDKKILYIHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPE
    NCTC8325        LDDMQVFRFNFRHQIDKKILYIHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPE
    Newman          LDDMQVFRFNFRHQIDKKILYIHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPE
    USA300_FPR3757  LDDMQVFRFNFRHQIDKKILYIHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPE
                    ************************************************************

    COL             FHIDDTFQAIQRVYDQLVSEVGHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLIS
    N315            FHIDDTFQAIQRVYDQLVSEVGHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLIS
    NCTC8325        FHIDDTFQAIQRVYDQLVSEVGHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLIS
    Newman          FHIDDTFQAIQRVYDQLVSEVGHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLIS
    USA300_FPR3757  FHIDDTFQAIQRVYDQLVSEVGHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLIS
                    ************************************************************

    COL             PILDATLSNKDISDALIEQDAVLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVY
    N315            PILDATLSNKDISDALIEQDAVLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVY
    NCTC8325        PILDATLSNKDISDALIEQDAVLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVY
    Newman          PILDATLSNKDISDALIEQDAVLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVY
    USA300_FPR3757  PILDATLSNKDISDALIEQDAVLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVY
                    ************************************************************

    COL             MFGGGREMTHPDMKLFEQMMLQHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDE
    N315            MFGGGREMTHPDMKLFEQMMLQHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDE
    NCTC8325        MFGGGREMTHPDMKLFEQMMLQHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDE
    Newman          MFGGGREMTHPDMKLFEQMMLQHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDE
    USA300_FPR3757  MFGGGREMTHPDMKLFEQMMLQHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDE
                    ************************************************************

    COL             DVTQNN
    N315            DVTQNN
    NCTC8325        DVTQNN
    Newman          DVTQNN
    USA300_FPR3757  DVTQNN
                    ******