From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005852000
  • symbol?:
  • description?: MFS transporter

      descriptions from strain specific annotations:

    • MFS transporter
    • EmrB/QacA family drug resistance transporter
    • drug resistance transporter EmrB/QacA subfamily protein
    • multidrug resistance protein B, drug resistance transporter
    • drug resistance MFS transporter, drug:H+ antiporter-1 (14 Spanner) (DHA2) family protein
    • drug resistance transporter, EmrB/QacA subfamily
    • EmrB/QacA subfamily drug resistance transporter
    • H+ antiporter-2 family protein
    • major facilitator superfamily multidrug:cation symporter
    • Membrane component of multidrug resistance system
    • MFS family major facilitator multidrug:cation transporter
    • multidrug ABC transporter
    • multidrug resistance protein
    • multidrug resistance transporter
    • putative transport protein
  • strand?: -
  • coordinates?: 5928738..5930675
  • synteny block?: BlockID0045970
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2291
    08BA02176:
    C248_2395
    11819-97:
    MS7_2370
    71193:
    ST398NM01_2404
    ECT-R 2:
    ECTR2_2212
    ED133:
    SAOV_2395c
    ED98:
    SAAV_2416
    HO 5096 0412:
    SAEMRSA15_22500
    JH1:
    SaurJH1_2422
    JH9:
    SaurJH9_2376
    JKD6008:
    SAA6008_02389
    JKD6159:
    SAA6159_02256
    LGA251:
    SARLGA251_21340
    M013:
    M013TW_2309
    MRSA252:
    SAR2437
    MSHR1132:
    SAMSHR1132_21770
    MSSA476:
    SAS2243
    Mu3:
    SAHV_2336
    Mu50:
    SAV2352
    MW2:
    MW2273
    RF122:
    SAB2231c
    ST398:
    SAPIG2404
    T0131:
    SAT0131_02539
    TCH60:
    HMPREF0772_10842
    TW20:
    SATW20_24830
    USA300_TCH1516:
    USA300HOU_2333
    VC40:
    SAVC_10620

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTTFIISYIILALIIVGVINLFLIRSRKKGKRQQKEQQFTTRQSNQSKFKASDLDKTTD
    N315            MTTTFIISYIILALIIVGVINLFLIRSRKKGKRQQKEQQFTTRQSNQSKFKASDLDKTTD
    NCTC8325        MTTTFIISYIILALIIVGVINLFLIRSRKKGKRQQKEQQFTTRQSNQSKFKASDLDKTTD
    Newman          MTTTFIISYIILALIIVGVINLFLIRSRKKGKRQQKEQQFTTRQSNQSKFKASDLDKTTD
    USA300_FPR3757  MTTTFIISYIILALIIVGVINLFLIRSRKKGKRQQKEQQFTTRQSNQSKFKASDLDKTTD
                    ************************************************************

    COL             QSTQRMTHEELRVDNQDDHSQVSLNGYTKGSEKDQEAFTNNKDEEAVAAKNPESEEYKVN
    N315            QSTQRMTHEELRVDNQDDHSQVSLNGYTKGSEKDQEAFTNNNGEEAVAAKNPESEEYKVN
    NCTC8325        QSTQRMTHEELRVDNQDDHSQVSLNGYTKGSEKDQEAFTNNKDEEAVAAKNPESEEYKVN
    Newman          QSTQRMTHEELRVDNQDDHSQVSLNGYTKGSEKDQEAFTNNKDEEAVAAKNPESEEYKVN
    USA300_FPR3757  QSTQRMTHEELRVDNQDDHSQVSLNGYTKGSEKDQEAFTNNKDEEAVAAKNPESEEYKVN
                    *****************************************:.*****************

    COL             EKIKKEHKNFIFGEGVSRGKILAALLFGMFIAILNQTLLNVALPKINTEFNISASTGQWL
    N315            EKIKKEHKNFIFGEGVSRGKILAALLFGMFIAILNQTLLNVALPKINTEFNISASTGQWL
    NCTC8325        EKIKKEHKNFIFGEGVSRGKILAALLFGMFIAILNQTLLNVALPKINTEFNISASTGQWL
    Newman          EKIKKEHKNFIFGEGVSRGKILAALLFGMFIAILNQTLLNVALPKINTEFNISASTGQWL
    USA300_FPR3757  EKIKKEHKNFIFGEGVSRGKILAALLFGMFIAILNQTLLNVALPKINTEFNISASTGQWL
                    ************************************************************

    COL             MTGFMLVNGILIPITAYLFNKYSYRKLFLVALVLFTIGSLICAISMNFPIMMVGRVLQAI
    N315            MTGFMLVNGILIPITAYLFNKYSYRKLFLVALVLFTIGSLICAISMNFPIMMVGRVLQAI
    NCTC8325        MTGFMLVNGILIPITAYLFNKYSYRKLFLVALVLFTIGSLICAISMNFPIMMVGRVLQAI
    Newman          MTGFMLVNGILIPITAYLFNKYSYRKLFLVALVLFTIGSLICAISMNFPIMMVGRVLQAI
    USA300_FPR3757  MTGFMLVNGILIPITAYLFNKYSYRKLFLVALVLFTIGSLICAISMNFPIMMVGRVLQAI
                    ************************************************************

    COL             GAGVLMPLGSIVIITIYPPEKRGAAMGTMGIAMILAPAIGPTLSGYIVQNYHWNVMFYGM
    N315            GAGVLMPLGSIVIITIYPPEKRGAAMGTMGIAMILAPAIGPTLSGYIVQNYHWNVMFYGM
    NCTC8325        GAGVLMPLGSIVIITIYPPEKRGAAMGTMGIAMILAPAIGPTLSGYIVQNYHWNVMFYGM
    Newman          GAGVLMPLGSIVIITIYPPEKRGAAMGTMGIAMILAPAIGPTLSGYIVQNYHWNVMFYGM
    USA300_FPR3757  GAGVLMPLGSIVIITIYPPEKRGAAMGTMGIAMILAPAIGPTLSGYIVQNYHWNVMFYGM
                    ************************************************************

    COL             FIIGIIAILIGFVWFKLYQYTTNPKADIPGIIFSTIGFGALLYGFSEAGNKGWGSVEIET
    N315            FIIGIIAILVGFVWFKLYQYTTNPKADIPGIIFSTIGFGALLYGFSEAGNKGWGSVEIET
    NCTC8325        FIIGIIAILIGFVWFKLYQYTTNPKADIPGIIFSTIGFGALLYGFSEAGNKGWGSVEIET
    Newman          FIIGIIAILIGFVWFKLYQYTTNPKADIPGIIFSTIGFGALLYGFSEAGNKGWGSVEIET
    USA300_FPR3757  FIIGIIAILIGFVWFKLYQYTTNPKADIPGIIFSTIGFGALLYGFSEAGNKGWGSVEIET
                    *********:**************************************************

    COL             MFAIGIIFIILFVIRELRMKSPMLNLEVLKFPTFTLTTIINMVVMLSLYGGMILLPIYLQ
    N315            MFAIGIIFIILFVIRELRMKSPMLNLEVLKFPTFTLTTIINMVVMLSLYGGMILLPIYLQ
    NCTC8325        MFAIGIIFIILFVIRELRMKSPMLNLEVLKFPTFTLTTIINMVVMLSLYGGMILLPIYLQ
    Newman          MFAIGIIFIILFVIRELRMKSPMLNLEVLKFPTFTLTTIINMVVMLSLYGGMILLPIYLQ
    USA300_FPR3757  MFAIGIIFIILFVIRELRMKSPMLNLEVLKFPTFTLTTIINMVVMLSLYGGMILLPIYLQ
                    ************************************************************

    COL             NLRGFSALDSGLLLLPGSLIMGLLGPFAGKLLDTIGLKPLAIFGIAVMTYATWELTKLNM
    N315            NLRGFSALDSGLLLLPGSLIMGLLGPFAGKLLDTIGLKPLAIFGIAVMTYATWELTKLNM
    NCTC8325        NLRGFSALDSGLLLLPGSLIMGLLGPFAGKLLDTIGLKPLAIFGIAVMTYATWELTKLNM
    Newman          NLRGFSALDSGLLLLPGSLIMGLLGPFAGKLLDTIGLKPLAIFGIAVMTYATWELTKLNM
    USA300_FPR3757  NLRGFSALDSGLLLLPGSLIMGLLGPFAGKLLDTIGLKPLAIFGIAVMTYATWELTKLNM
                    ************************************************************

    COL             DTPYMTIMGIYVLRSFGMAFIMMPMVTAAINALPGRLASHGNAFLNTMRQLAGSIGTAIL
    N315            DTPYMTIMGIYVLRSFGMAFIMMPMVTAAINALPGRLASHGNAFLNTMRQLAGSIGTAIL
    NCTC8325        DTPYMTIMGIYVLRSFGMAFIMMPMVTAAINALPGRLASHGNAFLNTMRQLAGSIGTAIL
    Newman          DTPYMTIMGIYVLRSFGMAFIMMPMVTAAINALPGRLASHGNAFLNTMRQLAGSIGTAIL
    USA300_FPR3757  DTPYMTIMGIYVLRSFGMAFIMMPMVTAAINALPGRLASHGNAFLNTMRQLAGSIGTAIL
                    ************************************************************

    COL             VTVMTTQTTQHLSAFGEELDKTNPVVQDHMRELASQYGGQEGAMKVLLQFVNKLATVEGI
    N315            VTVMTTQTTQHLSAFGEELDKTNPVVQDHMRELASQYGGQEGAMKVLLQFVNKLATVEGI
    NCTC8325        VTVMTTQTTQHLSAFGEELDKTNPVVQDHMRELASQYGGQEGAMKVLLQFVNKLATVEGI
    Newman          VTVMTTQTTQHLSAFGEELDKTNPVVQDHMRELASQYGGQEGAMKVLLQFVNKLATVEGI
    USA300_FPR3757  VTVMTTQTTQHLSAFGEELDKTNPVVQDHMHELASQYGGQEGAMKVLLQFVNKLATVEGI
                    ******************************:*****************************

    COL             NDAFIVATIFSIIALILCLFLQSNKKAKATAQKLDADNSINHE
    N315            NDAFIVATIFSIIALILCLFLQSNKKAKATAQKLEASSNNNHE
    NCTC8325        NDAFIVATIFSIIALILCLFLQSNKKAKATAQKLDADNSINHE
    Newman          NDAFIVATIFSIIALILCLFLQSNKKAKATAQKLDADNSINHE
    USA300_FPR3757  NDAFIVATIFSIIALILCLFLQSNKKAKATAQKLDADNSINHE
                    **********************************:*... ***