From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005865000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • EpiH/GdmH-like protein
    • Integral membrane protein
  • strand?: +
  • coordinates?: 5938424..5939395
  • synteny block?: BlockID0046100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2297
    08BA02176:
    C248_2403
    11819-97:
    MS7_2376
    71193:
    ST398NM01_2411
    ECT-R 2:
    ECTR2_2218
    ED133:
    SAOV_2402
    ED98:
    SAAV_2423
    HO 5096 0412:
    SAEMRSA15_22560
    JH1:
    SaurJH1_2428
    JH9:
    SaurJH9_2382
    JKD6008:
    SAA6008_02395
    JKD6159:
    SAA6159_02262
    LGA251:
    SARLGA251_21400
    M013:
    M013TW_2316
    MRSA252:
    SAR2444
    MSHR1132:
    SAMSHR1132_21830
    MSSA476:
    SAS2249
    Mu3:
    SAHV_2342
    Mu50:
    SAV2358
    MW2:
    MW2279
    RF122:
    SAB2237
    ST398:
    SAPIG2411
    T0131:
    SAT0131_02545
    TCH60:
    HMPREF0772_10834
    TW20:
    SATW20_24890
    USA300_TCH1516:
    USA300HOU_2340
    VC40:
    SAVC_10655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLNLLLIFILIVICPLIFNYTLTLNLTCYILVVISIFLSLIYSIMTYTFPWSMFVTFII
    N315            MLLNLLLIFILIVICPLIFNYTLTLNLTCYILVVISIFLSLIYSIMTYTFPWSMFVTFII
    NCTC8325        MLLNLLLIFILIVICPLIFNYTLTLNLTCYILVVISIFLSLIYSIMTYTFPWSMFVTFII
    Newman          MLLNLLLIFILIVICPLIFNYTLTLNLTCYILVVISIFLSLIYSIMTYTFPWSMFVTFII
    USA300_FPR3757  MLLNLLLIFILIVICPLIFNYTLTLNLTCYILVVISIFLSLIYSIMTYTFPWSMFVTFII
                    ************************************************************

    COL             ISIIMLFKHRYLFSHTSSRLFIKKLLSFSYKFVLYTSALLFISTIQSPIVKGLSMWLAIL
    N315            ISIIMLFKHRYLFSHTSSRLFIKKLLSFSYKFVLYTSALLFISTIQSPIVKGLSMWLAIL
    NCTC8325        ISIIMLFKHRYLFSHTSSRLFIKKLLSFSYKFVLYTSALLFISTIQSPIVKGLSMWLAIL
    Newman          ISIIMLFKHRYLFSHTSSRLFIKKLLSFSYKFVLYTSALLFISTIQSPIVKGLSMWLAIL
    USA300_FPR3757  ISIIMLFKHRYLFSHTSSRLFIKKLLSFSYKFVLYTSALLFISTIQSPIVKGLSMWLAIL
                    ************************************************************

    COL             CLSLLLTFICYLVWTVSYRHRSYNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIYQQQ
    N315            CLSLLLTFICYLVWTVSYRHRSYNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIYQQQ
    NCTC8325        CLSLLLTFICYLVWTVSYRHRSYNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIYQQQ
    Newman          CLSLLLTFICYLVWTVSYRHRSYNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIYQQQ
    USA300_FPR3757  CLSLLLTFICYLVWTVSYRHRSYNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIYQQQ
                    ************************************************************

    COL             ASATKIIVSGGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINN
    N315            ASATKIIVSGGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINN
    NCTC8325        ASATKIIVSGGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINN
    Newman          ASATKIIVSGGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINN
    USA300_FPR3757  ASATKIIVSGGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINN
                    ************************************************************

    COL             LYHEAVKIVCVTSQFHVLRALRLAQKLGLSIDGVGSHTPYHFFLHVLIKDYLGVMYQYRL
    N315            LYHEAVKIVCVTSQFHVLRALRLAQKLGLSIDGVGSHTPYHFFLHVLIKDYLGVMYQYRL
    NCTC8325        LYHEAVKIVCVTSQFHVLRALRLAQKLGLSIDGVGSHTPYHFFLHVLIKDYLGVMYQYRL
    Newman          LYHEAVKIVCVTSQFHVLRALRLAQKLGLSIDGVGSHTPYHFFLHVLIKDYLGVMYQYRL
    USA300_FPR3757  LYHEAVKIVCVTSQFHVLRALRLAQKLGLSIDGVGSHTPYHFFLHVLIKDYLGVMYQYRL
                    ************************************************************

    COL             LLTLYCSSSWFICLYAAFIYNS
    N315            LLTLYCSSSWFICLYAAFIYNS
    NCTC8325        LLTLYCSSSWFICLYAAFIYNS
    Newman          LLTLYCSSSWFICLYAAFIYNS
    USA300_FPR3757  LLTLYCSSSWFICLYAAFIYNS
                    **********************