From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005871000
  • symbol?: hssS
  • description?: two component histidine kinase sensor

      descriptions from strain specific annotations:

    • two component histidine kinase sensor
    • integral membrane sensor signal transduction histidine kinase
    • ATPase
    • sensor histidine kinase
    • Sensor histidine kinase colocalized with HrtAB transporter
    • HAMP domain protein
    • heme sensor protein hssS
    • sensor kinase
    • hemin sensor histidine kinase
    • sensor kinase protein
    • two-component sensor histidine kinase sensor
    • two component system histidine kinase
  • strand?: +
  • coordinates?: 5943067..5944440
  • synteny block?: BlockID0046160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2301
    08BA02176:
    C248_2407
    11819-97:
    MS7_2380 (hssS)
    71193:
    ST398NM01_2415
    ECT-R 2:
    ECTR2_2222
    ED133:
    SAOV_2406
    ED98:
    SAAV_2427
    HO 5096 0412:
    SAEMRSA15_22600
    JH1:
    SaurJH1_2432
    JH9:
    SaurJH9_2386
    JKD6008:
    SAA6008_02400 (hssS)
    JKD6159:
    SAA6159_02266 (hssS)
    LGA251:
    SARLGA251_21450 (hssS)
    M013:
    M013TW_2320
    MRSA252:
    SAR2448
    MSHR1132:
    SAMSHR1132_21870
    MSSA476:
    SAS2253
    Mu3:
    SAHV_2346
    Mu50:
    SAV2362
    MW2:
    MW2283
    RF122:
    SAB2241
    ST398:
    SAPIG2415
    T0131:
    SAT0131_02550
    TCH60:
    HMPREF0772_10830 (hssS)
    TW20:
    SATW20_24940 (hssS)
    USA300_TCH1516:
    USA300HOU_2345 (hssS)
    VC40:
    SAVC_10680

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP
    N315            MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP
    NCTC8325        MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP
    Newman          MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP
    USA300_FPR3757  MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP
                    ************************************************************

    COL             THIQQYFKHLGQMNYQIMTIDQKGHKTFYGEPFREDTLSQNAINNVLNNQDYHGIKDKPF
    N315            THIQQYFKHLGQMNYQIMTVDQKGHKTFYGEPFREDTLSQNAINNVLNNKDYHGIKDKPF
    NCTC8325        THIQQYFKHLGQMNYQIMTIDQKGHKTFYGEPFREDTLSQNAINNVLNNQDYHGIKDKPF
    Newman          THIQQYFKHLGQMNYQIMTIDQKGHKTFYGEPFREDTLSQNAINNVLNNQDYHGIKDKPF
    USA300_FPR3757  THIQQYFKHLGQMNYQIMTIDQKGHKTFYGEPFREDTLSQNAINNVLNNQDYHGIKDKPF
                    *******************:*****************************:**********

    COL             ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL
    N315            ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL
    NCTC8325        ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL
    Newman          ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL
    USA300_FPR3757  ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL
                    ************************************************************

    COL             VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR
    N315            VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR
    NCTC8325        VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR
    Newman          VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR
    USA300_FPR3757  VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR
                    ************************************************************

    COL             QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE
    N315            QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE
    NCTC8325        QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE
    Newman          QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE
    USA300_FPR3757  QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE
                    ************************************************************

    COL             LDNHQHLLFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL
    N315            LDNHQHLLFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL
    NCTC8325        LDNHQHLLFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL
    Newman          LDNHQHLLFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL
    USA300_FPR3757  LDNHQHLLFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL
                    ***************:********************************************

    COL             LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL
    N315            LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL
    NCTC8325        LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL
    Newman          LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL
    USA300_FPR3757  LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL
                    ************************************************************

    COL             GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSL
    N315            GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSH
    NCTC8325        GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSL
    Newman          GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSL
    USA300_FPR3757  GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSL
                    ************************************