Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005872000
  • symbol?:
  • description?: lytTr DNA-binding domain protein

      descriptions from strain specific annotations:

    • lytTr DNA-binding domain protein
    • LytTr DNA-binding region-containing protein
    • transcriptional regulator
    • LytTr DNA-binding domain family
    • HTH-type transcriptional regulator
  • strand?: +
  • coordinates?: 5944603..5945046
  • synteny block?: BlockID0046170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2302
    08BA02176:
    C248_2408
    11819-97:
    MS7_2381
    71193:
    ST398NM01_2416
    ECT-R 2:
    ECTR2_2223
    ED133:
    SAOV_2407
    ED98:
    SAAV_2428
    HO 5096 0412:
    SAEMRSA15_22610
    JH1:
    SaurJH1_2433
    JH9:
    SaurJH9_2387
    JKD6008:
    SAA6008_02401 (lytT)
    JKD6159:
    SAA6159_02267 (lytT)
    LGA251:
    SARLGA251_21460
    M013:
    M013TW_2321
    MRSA252:
    SAR2449
    MSHR1132:
    SAMSHR1132_21880
    MSSA476:
    SAS2254
    Mu3:
    SAHV_2347
    Mu50:
    SAV2363
    MW2:
    MW2284
    RF122:
    SAB2242
    ST398:
    SAPIG2416
    T0131:
    SAT0131_02551 (tnpB-3)
    TCH60:
    HMPREF0772_10829
    TW20:
    SATW20_24950
    USA300_TCH1516:
    USA300HOU_2346
    VC40:
    SAVC_10685

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMKLNLFINANETESYIDIHAPKMNDNVQSIINAVNDLDKSHTLVGYIDKEIHIINVSDV
    N315            MMKLNLFINANETESYIDIHAPKMNDHVQSIINAVNDLDKSHTLVGYIDKEIHIINVSDV
    NCTC8325        MMKLNLFINANETESYIDIHAPKMNDNVQSIINAVNDLDKSHTLVGYIDKEIHIINVSDV
    Newman          MMKLNLFINANETESYIDIHAPKMNDNVQSIINAVNDLDKSHTLVGYIDKEIHIINVSDV
    USA300_FPR3757  MMKLNLFINANETESYIDIHAPKMNDNVQSIINAVNDLDKSHTLVGYIDKEIHIINVSDV
                    **************************:*********************************

    COL             ITFQVINKNVTAITSNQKFKLKLRLYELEKQLPQHFIRISKSEIVNKYYIEKLLLEPNGL
    N315            ITFQVINKNVTAITSNQKFKLKLRLYELEKQLPQHFIRISKSEIVNKYYIEKLLLEPNGL
    NCTC8325        ITFQVINKNVTAITSNQKFKLKLRLYELEKQLPQHFIRISKSEIVNKYYIEKLLLEPNGL
    Newman          ITFQVINKNVTAITSNQKFKLKLRLYELEKQLPQHFIRISKSEIVNKYYIEKLLLEPNGL
    USA300_FPR3757  ITFQVINKNVTAITSNQKFKLKLRLYELEKQLPQHFIRISKSEIVNKYYIEKLLLEPNGL
                    ************************************************************

    COL             IRMYLKDAHYTYSSRRYLKSIKERLSI
    N315            IRMYLKDAHYTYSSRRYLKSIKERLSI
    NCTC8325        IRMYLKDAHYTYSSRRYLKSIKERLSI
    Newman          IRMYLKDAHYTYSSRRYLKSIKERLSI
    USA300_FPR3757  IRMYLKDAHYTYSSRRYLKSIKERLSI
                    ***************************