From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005885000
  • symbol?: paiA
  • description?: N-acetyltransferase

      descriptions from strain specific annotations:

    • N-acetyltransferase
    • acetyltransferase
    • acetyltransferase, GNAT family protein
    • acetyltransferase (GNAT) family protein
    • acetyltransferase, GNAT family hypothetical protein
    • GNAT family acetyltransferase
    • N-acetyltransferase GCN5
    • protease synthase and sporulation negative regulatory protein PAI 1
    • transcriptional regulator
    • transcription repressor of sporulation, septation and degradation PaiA
  • strand?: -
  • coordinates?: 5957159..5957674
  • synteny block?: BlockID0046300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2308 (paiA)
    08BA02176:
    C248_2416
    11819-97:
    MS7_2387 (paiA)
    71193:
    ST398NM01_2423
    ECT-R 2:
    ECTR2_2229
    ED133:
    SAOV_2416c
    ED98:
    SAAV_2434
    HO 5096 0412:
    SAEMRSA15_22700
    JH1:
    SaurJH1_2439
    JH9:
    SaurJH9_2393
    JKD6008:
    SAA6008_02407
    JKD6159:
    SAA6159_02273
    LGA251:
    SARLGA251_21550
    M013:
    M013TW_2330
    MRSA252:
    SAR2458
    MSHR1132:
    SAMSHR1132_21970
    MSSA476:
    SAS2260
    Mu3:
    SAHV_2353
    Mu50:
    SAV2369
    MW2:
    MW2290
    RF122:
    SAB2249c
    ST398:
    SAPIG2423
    T0131:
    SAT0131_02559 (ftsQ)
    TCH60:
    HMPREF0772_10819
    TW20:
    SATW20_25010
    USA300_TCH1516:
    USA300HOU_2352
    VC40:
    SAVC_10715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAGIIKEISEQNASELVELATRTFYDTFGSYYDDKDFDQFFKDNYTVEKFTQEINHVDSF
    N315            MAGIIKEISEQNASELVELATRTFYDTFGSYYDDKDFDQFFKDNYTVEKFTQEINHVDSF
    NCTC8325        MAGIIKEISEQNASELVELATRTFYDTFGSYYDDKDFDQFFKDNYTVEKFTQEINHVDSF
    Newman          MAGIIKEISEQNASELVELATRTFYDTFGSYYDDKDFDQFFKDNYTVEKFTQEINHVDSF
    USA300_FPR3757  MAGIIKEISEQNASELVELATRTFYDTFGSYYDDKDFDQFFKDNYTVEKFTQEINHVDSF
                    ************************************************************

    COL             HYFYQEDGANVGYIKMNINSAQTEEMGETYLEVQRIYFLKDFQGGGRGSQLIELAEKIAQ
    N315            HYFYQEDGANVGYIKMNINSAQTEEMGETYLEVQRIYFLKDFQGGGRGSQLIELAEKIAQ
    NCTC8325        HYFYQEDGANVGYIKMNINSAQTEEMGETYLEVQRIYFLKDFQGGGRGSQLIELAEKIAQ
    Newman          HYFYQEDGANVGYIKMNINSAQTEEMGETYLEVQRIYFLKDFQGGGRGSQLIELAEKIAQ
    USA300_FPR3757  HYFYQEDGANVGYIKMNINSAQTEEMGETYLEVQRIYFLKDFQGGGRGSQLIELAEKIAQ
                    ************************************************************

    COL             EHNKHKIWLGVWEHNPRAQAFYKRHGFKVVGEHHFQTGDVTDTDLIMEKEL
    N315            EHNKHKIWLGVWEHNPRAQAFYKRHGFKVVGEHHFQTGDVTDTDLIMEKEL
    NCTC8325        EHNKHKIWLGVWEHNPRAQAFYKRHGFKVVGEHHFQTGDVTDTDLIMEKEL
    Newman          EHNKHKIWLGVWEHNPRAQAFYKRHGFKVVGEHHFQTGDVTDTDLIMEKEL
    USA300_FPR3757  EHNKHKIWLGVWEHNPRAQAFYKRHGFKVVGEHHFQTGDVTDTDLIMEKEL
                    ***************************************************