From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005889000
  • symbol?:
  • description?: attachment to host cells and virulence

      descriptions from strain specific annotations:

    • attachment to host cells and virulence
    • N-acetyltransferase GCN5
    • acetyltransferase (GNAT) family protein
    • GNAT family acetyltransferase
    • Acetyltransferase (GNAT) family
    • putative acetyltransferase (GNAT) familyprotein
    • acetyltransferase, gnat family
    • acetyltransferase, GNAT family protein
  • strand?: -
  • coordinates?: 5961589..5961924
  • synteny block?: BlockID0046340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2310
    08BA02176:
    C248_2418
    11819-97:
    MS7_2389
    71193:
    ST398NM01_2425
    ECT-R 2:
    ECTR2_2231
    ED133:
    SAOV_2418c
    ED98:
    SAAV_2436
    HO 5096 0412:
    SAEMRSA15_22720
    JH1:
    SaurJH1_2441
    JH9:
    SaurJH9_2395
    JKD6008:
    SAA6008_02409
    JKD6159:
    SAA6159_02275
    LGA251:
    SARLGA251_21570
    M013:
    M013TW_2332
    MRSA252:
    SAR2460
    MSHR1132:
    SAMSHR1132_22000
    MSSA476:
    SAS2263
    Mu3:
    SAHV_2355
    Mu50:
    SAV2371
    MW2:
    MW2293
    RF122:
    SAB2251c
    ST398:
    SAPIG2425
    T0131:
    SAT0131_02561 (ftsA)
    TCH60:
    HMPREF0772_10817
    TW20:
    SATW20_25030
    USA300_TCH1516:
    USA300HOU_2354
    VC40:
    SAVC_10725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKVTYDIPTCEDYCALRINAGMSPKTREAAEKGLPNALFTVTLYDKDRLIGMGRVIGDG
    N315            MVKVTYDIPTCEDYCALRINAGMSPKTREAAEKGLPNALFTVTLYDKDRLIGMGRVIGDG
    NCTC8325        ----------------------MSPKTREAAEKGLPNALFTVTLYDKDRLIGMGRVIGDG
    Newman          MVKVTYDIPTCEDYCALRINAGMSPKTREAAEKGLPNALFTVTLYDKDRLIGMGRVIGDG
    USA300_FPR3757  MVKVTYDIPTCEDYCALRINAGMSPKTREAAEKGLPNALFTVTLYDKDRLIGMGRVIGDG
                                          **************************************

    COL             GTVFQIVDIAVLKSYQGQGYGSLIMEHIMQYIKGVAVESTYVSLIADYPADKLYTKFGFI
    N315            GTVFQIVDIAVSKSYQGQDYGSLIMEHIMKYIKNVSVESAYVSLIADYPADKLYAKFGFM
    NCTC8325        GTVFQIVDIAVLKSYQGQGYGSLIMEHIMQYIKGVAVESTYVSLIADYPADKLYTKFGFI
    Newman          GTVFQIVDIAVLKSYQGQGYGSLIMEHIMQYIKGVAVESTYVSLIADYPADKLYTKFGFI
    USA300_FPR3757  GTVFQIVDIAVLKSYQGQGYGSLIMEHIMQYIKGVAVESTYVSLIADYPADKLYTKFGFI
                    *********** ******.**********:***.*:***:**************:****:

    COL             PTEPDSGGMYIKY
    N315            PTEPDSGGMYIKY
    NCTC8325        PTEPDSGGMYIKY
    Newman          PTEPDSGGMYIKY
    USA300_FPR3757  PTEPDSGGMYIKY
                    *************